
This page will have lyrics to most commonly sung songs in any Hindu household.
I have been using a free software called Baraha to write Kannada in English and using the normal keyboard. Within just a few minutes after you download the software you are ready to start using the program. It’s so easy. I use this software to write emails to my Mother-in-law in Bangalore.

I am also using this to write all the lyrics I am adding in my web log as well. This software isn’t just for Kannada, you can also write Devanagari, Tamil, Telugu, Malayalam, Gujarati and many other languages. I have tested my lyrics with Kannada & Devanagari. Copy all the lyrics from this weblog and paste it in the bottom half of the software, and click on the Convert toolbar button. Its really fun and easy. If you are having any problems using this software, just reply to this thread. I will help you.

If you want any of these lyrics in any particular language Baraha supports, comment to any of these pages, and I will send you the lyrics in the language you need. 🙂

Here is a screen shot of Shri Mahalakshmi Ashtakam lyrics written in Baraha:

Baraha Software at work

And here it is in Devanagari script:

Lyrics in Devanagiri

I had completely forgotten to update the lyrics page whenever I added new ones. Mr. Nandan, who is currently sending many lyrics for famous devotional songs sent me a excel spread sheet with all the titles. I made one more change and added links to those. This would help all the visitors to easily search for any lyrics they want and click on the link. So, here comes the list in alphabetical order which from now onwards will be updated as and when a new ones is added.

Name Lyrics/Stotra On

Ane Bantane Batane Bantamma
Lord Krishna
Aaruthi Belagire Goddess Lakshmi
Acharavillada Nalige Lord Krishna
Andavada toyadada chandavada padadinda Lord Krishna
Anjikinyatakayya Sajjanarige Bhayavu Inyatakayya Lord Hanuman
banda duritagaLa pariharisalu namma Lord Venkatesha
bandano gOvinda chandadi Ananda Lord Venkatesha
bandakriShNa Chandadinda banda nODe Lord Krishna
Banda Manmanasake Sri Hari Sri Hari
Baro bega baro nila meghavarna baro Lord Krishna
baro brahmadivandya vasudeva sutane Lord Krishna
Baro Guru Raghavendra Sri Raghavendra Swamy
Baro manake he Srinivasa Lord Srinivasa
Baro namma manege gopalakrishna Lord Krishna
Bhagyada Lakshmi Baramma Goddess Lakshmi
Bhagyada Lakshmi Baramma – English Translation Goddess Lakshmi
Baare Nammamanitanaka Goddess Lakshmi
Daily Tulasi Pooja Procedure Tulasi
Dasana madiko enna Lord Krishna
Dariyavudayya Vaikuntake Dari Torisayya lyrics Lord Krishna
Deva Banda Namma Lord Krishna
Dasanagu Visheshanagu Lord Krishna
Enu Sukrutha by Shri Vadirajaru Lord Krishna
Enu Sukrutha Maadidalo Taa Yashode Lord Krishna
Gajamukhane Ganapathiye Lord Ganesha
Gatika chaladi ninta sri hanumanta Lord Hanuman
Gajavadhanaa beduve Lord Ganesha
Hanuma Namma Thayi Thande Lord Hanuman
Harivarasanam Viswamohanam Lord Aayappa
Hayagreeva Sampada Stotra Lord Hayagreeva
Indu Yenage Govinda Lord Krishna
Ishtu Dina Ee Vaikunta Lord Vishnu
Ivanyaro Yeno Lord Krishna
Jagadoddharana adisidale yashode Lord Krishna
Jai Jai Vittala Panduranga Lord Panduranga
Jaya Jaya Veeve Raghavendra Sri Raghavendra Swamy
JoJo JoKrishna Paramananda Lord Krishna
Kapadu Sri SatyaNarayana Lord SatyaNarayana
Kande Naa Govindana Lord Krishna
Keshava Nama in English Lord Krishna
Keshava Nama in Kannada Lord Krishna
Krishna Nee begane Baaro Lord Krishna
kriShNamUruti kaNNamunde nintante ide Lord Krishna
Lambodara Lakumikara Lord Ganesha
Lakshmi Shobane Lyrics Goddess Lakshmi
Loka Bharithano Ranga Lord Krishna
Lord Ganesha Slokas Lord Ganesha
Mahishasura Mardini Stotra Goddess Chamundeshwari
Mahishasura Mardini Stotra in Different Languages Goddess Chamundeshwari
MangaLArati tandu beLagire Goddess Lakshmi
Nagara Panchami Haadu
Nammamma Sharade Uma Maheswari Goddess Sharade
Narayana Varma – Narayana Kavacha Lord Narayana
Nere Namdhide Lord Panduranga
Neen Yako Ninna Hangyaako Lord Rama, Krishna
Novu Talalare Hariye Lord Krishna
Pahi Pahi Raghavendra Guru Sri Raghavendra Swamy
Palayachyutha palayajitha Stotra Lord Krishna
Pavamana JagadaPrana Lord Hanuman
Poojipene Ninna in Kannada Goddess Lakshmi
Poojipene Ninna in English Goddess Lakshmi
Pillangoviya Chelva Krishnana Elli Nodidiri Lord Krishna
Prayer To Recite While Traveling Lord Vishnu
Prayer for Recovering Lost Items
Preenayamo Vasudevam stotra Lord Krishna
rAjabeediyoLagininda kastUriranga Lord Krishna
Ramakrishnaru manege bandaru Lord Krishna
Raghavendra Guru Rayara Sevisiro Sri Raghavendra Swamy
Rathava Nerida Raghavendra Sri Raghavendra Swamy
Ranga Baro Panduranga Baro Lord Panduranga
Raya Baro Thande Thayi Baro Sri Raghavendra Swamy
Sampat Shukravarada Haadu Goddess Lakshmi
Sharanara Surabhoja Sri Raghavendra Swamy
Sharanu Sharanayya Lord Shiva
Sharanu Venkataramana Lord Venkatesha
Sharanu Siddhi Vinayaka Lord Ganesha
Shiva Stuthi Lord Shiva
Sri Lakshmi Pooja Vidhana Goddess Lakshmi
Shree Siddha Lakshmi Stotra in Kannada Goddess Lakshmi
Shri Ashta Lakshmi Stotra Goddess Lakshmi
Shri Hanuman Chalisa in Kannada Lord Hanuman
Shri lakshmi Hrudaya Goddess Lakshmi
Shri Mangala Devi Ninage Pranama Goddess Lakshmi
Shri Raghavendra Stotra Sri Raghavendra Swamy
Sri Ganesha Ashtotra Lord Ganesha
Sri Ganesha Dwadasanama Stotra Lord Ganesha
Sri Hanuman Chalisa in Kannada Lord Hanuman
Sri Krishna Ashtotra Lord Krishna
Sri Krishna Ashtakam Lord Krishna
Sri Madhwa Nama Guru Madhwacharya
Sri Madhwa Nama in Kannada Guru madhwacharya
Sri Mahalakshmi Ashtakam Goddess Lakshmi
Sri Mangala Devi Ninage Pranama Goddess Lakshmi
Sri Guru Raghavendra Swamigala Aarathi Song Sri Raghavendra Swamy
Sri Raghavendra Kavacham Sri Raghavendra Swamy
Sri Rama Ashtotra Lord Rama
Sri Rama Bhajane-Sri Nama Ramayana Lord Rama
Sri Saraswathi Slokas Goddess Saraswathi
Sri Saraswathi Slokas Goddess Saraswathi
Sri SatyaNarayana Slokas Lord SatyaNarayana
Sri Venkateshwara Bhajane Lord Venkatesha
Sri Venkatesha Mangalam Lord Venkatesha
Sri Venkatesha Prapathi Lord Venkatesha
Sri Venkatesha Stotra Lord Venkatesha
Sri Venkatesha Suprabhatha Lord Venkatesha
Sri Srinivasa kalyana Lord Venkatesha
Srinivasa Bhajane Lord Venkatesha
Sheshagiri Dore Namma Srinivasana Lord Venkatesha
Sripathiyu Namage Sampadaveeyali Lord Hanuman
Shyamala Dandaka Stothra
taaraka bindige Lord Rama
Thoogire Rayara Sri Raghavendra Swamy
Thugire Rangana Thugire Krishnana Lord Krishna
Thunga Theeradi Ninta Suyativara on Shri Raghavendra Swamy Sri Raghavendra Swamy
Thunga Theeravirajam Bhajamana Sri Raghavendra Swamy
Tulasi Pooje Slokas Tulasi
Vande Vandyam Lord Krishna
Vandipe Ninage Gananata Lord Ganesha
Varava Kode Thayi Goddess Lakshmi
Vatasavithri Pooja Sloka
Veera Hanuma Bahu Parakrama Lord Hanuman
Venkatesha Bedikombe krupeya paliso Lord Venkatesha
Venkata Ramanane Baaro Lord Venkatesha
Venkatachala Nilayam Lord Venkatesha
Vijaya Kavacha
Vyarthavallave janma vyarthavallave
Yeddu Baruthare Noode Sri Raghavendra Swany
Yenagu Aane Ranga Lord Krishna
Yenu Dhanyalo Lakumi Goddess Lakshmi

1,111 responses to this post.

  1. Posted by Raji on December 26, 2007 at 10:39 am

    Do you have the lyrics for “Lookveerayam mahapoojayam: in English. If you do have please email to my hotmail.


    • Raji,
      I heard and reciting this namaskara mantram at ayyappa mandala pooja past couple of weeks.. is this what you (were) looking for?

      Lokaveeryam Mahaapoojyam Sarvarakshakaram vibhum
      Parvathi hridayanandam Shaasthaaram pranmaamyaham – Swamiye Sharanam ayyappa

      Viprapoojyam vishwavandyam Vishnu shambho: priyamsutham
      Kshipraprasaadaniratham Shaasthaaram pranmaamyaham – Swamiye Sharanam ayyappa

      Mathamaathanga gamanam Kaarunyamruthapooritham
      Sarvavighnaharam devam Shaasthaaram pranmaamyaham – Swamiye Sharanam ayyappa

      Asmath kuleswaram devam Asmath shathru vinashanam
      Asmathishtta pradaathaaram Shaasthaaram pranmaamyaham – Swamiye Sharanam ayyappa

      Paandyesha vamsha thilakam Keraley keli vrigraham
      Aarthathraanaparam devam Sasthaaram pranmaamyaham – Swamiye Sharanam ayyappa

      Trayambaka Püraadeesham Ganaadipa Samanvitam
      Gajaarudam Aham Vande Shaastaaram KuIa Daivatam – Swamiye Sharanam ayyappa

      Shiva Veerya Samudhbhootam Sreenivaasa Tanudbhavam
      Shikee Vaahaatmajam Vande Shaastaaram Pranamaamyaham – Swamiye Sharanam ayyappa

      just found some portion of it on this website also –
      there are several other sites that might help you. While reciting, I’ve noticed versions with minor changes though..


      • Posted by Praveena on August 9, 2011 at 6:33 am

        Do you have the lyrics for Shri raghvendra suprabatham in english or tamil?

      • Posted by Nagendra on June 21, 2014 at 12:09 pm


        Can you please let me know the lyrics of Lakshmi kaantha baaro, shubha lakshana vantha baaro, Pakshi vaahana yeeridavane…..

        Thanks a lot.

    • Namaste for all your efforts. can anybody help to get lyrics of keerthana “Thri jagadhi pathe yaju nandana… Ranga turanga.. turanga.. viharaa… ” its an excellent keerthana heard in my childhood but no where found its lyrics, Kindly help me


    • Posted by Ganesh Shetty on August 25, 2016 at 12:30 am

      Namisi Beduve Varagala Ninna…………. Lyrics siga bahuda………


    • Posted by Sudha on September 12, 2016 at 2:48 pm

      Can any one of you post the lyrics:
      buddhi maata helidare kelabekamma magale composed by purandara dasaru.


      • Posted by on September 17, 2016 at 11:03 am

        NamaskaragaLuThe song asked by M/s Sudha is here. You may post on the blog please.P.S.T

      • Posted by on September 18, 2016 at 2:17 am

        As required by Mr Siva the transliteration to Tamil is given in enclosed file Sudha commented: “Can any one of you post the lyrics:buddhi maata helidare kelabekamma magale composed by purandara dasaru.” | | Respond to this comment by replying above this line |

        | | | |

        | New comment on Kalpavriksha Kamadhenu | |

        | | | Sudha commented on Lyrics. in response to Raji: Do you have the lyrics for “Lookveerayam mahapoojayam: in English. If you do have please email to my hotmail. Thanks Can any one of you post the lyrics: buddhi maata helidare kelabekamma magale composed by purandara dasaru. | Reply |    Comments |



        | Want less email? Unsubscribe from all follow-up comments or modify your Subscription Options. |


        | |


        | Thanks for flying with |


  2. Posted by meeraghu on December 26, 2007 at 10:49 am

    I am sorry, I haven’t heard this song. I don’t have the lyrics either.


    • Posted by Gopal on May 15, 2012 at 12:40 am

      Madam Can you find lyrics of This song ” Adavinilaya ninn adigadigeraguve kara pididu palisayya ….., Srutsthi yolage ati shrestha vendanisida kustagi pura vasa “.,,,,
      and this song belongs to Pranadevaru, this temple is at Kustagi Dist:Koppal Karnataka state.


    • Posted by Ravishankara on October 15, 2012 at 6:27 am

      Hi Ma’m,

      As per my link below, pls send kannada lyrics.



      • Posted by Pooja Shankar on August 4, 2015 at 10:48 am

        Hi Meera, Can you pl. post Kanakadhara stotram Kannada Lyrics? Thanks.\

      • Posted by on August 6, 2015 at 12:57 am

        Mam,The enclosed may be of help to your reader! You may upload in your Blog.P.S.T

  3. Posted by gayathri on January 17, 2008 at 9:15 pm

    Pls. send me:

    Gowri Ashtothara
    Ganesh Ashtothara
    Lakshmi Ashothara


  4. Posted by meeraghu on January 18, 2008 at 6:26 pm

    Hi Gayathri,
    I have added the link to the web site which has Ashtotra for all the Gods.
    Here is the link:


  5. Posted by shobha on February 20, 2008 at 1:27 am

    Hi Meera,
    thanks a lot for a great site for kannadigas.
    can u pls send me the slokas for kids in kannada. preferably small ones which they can read easily.


  6. Posted by Sudheendra on February 23, 2008 at 1:31 pm

    Awesome stuff!

    May Sri Hari-Vayu-Gurugalu Bless ya….

    Am going thru the blog… the way…


  7. Posted by Chandhu on February 25, 2008 at 2:32 am

    hi frnds if have a GITA SARA lyrics plzzzz send to my id…..i was searching that lyircs from long back …plzzzzzz help me ……


  8. Hi Meera,

    The lyrics that u have posted in ur blog are very much of help…Thanks:-)

    Wud u be having “Yenu Dhanyalo Lakumi ” lrics in english …because i was able see only the kannada script…..

    Thanks again!



  9. Posted by meeraghu on March 7, 2008 at 7:05 am

    Hi Vidya,
    Yes, I have it and I will post it.


  10. Posted by Shruti on April 9, 2008 at 8:42 pm

    Hi Meera,

    This is really a great site. Thanks a lot for all these lyrics.


  11. Posted by meeraghu on April 10, 2008 at 7:21 am

    Hi Shruti,
    Thanks so much. I am glad the slokas and the lyrics have been helping people.


  12. Posted by Murugesh on April 11, 2008 at 1:42 am

    Hi this is a good site for all


  13. Posted by Murugesh on April 11, 2008 at 1:44 am

    pls add enudhanyalo lakumi in english


  14. Posted by Shalini Gnana on April 11, 2008 at 9:28 am


    The lyrics you have posted for Sri Raghavendra Swami Songs are really helpful.Wud you be having the lyrics for “Jaya Jaya veeve Raghavendra” it will be very helpful(either Kannada/English is fine).If so, please post it on

    Thanks very much


  15. Posted by lakshmi on April 17, 2008 at 12:59 am

    Hi Meera,
    This is great website and very helpful.It will be great if we have lyrics of all great compositions of Haridasas and the lyrics of UgaBhoga and Sulaadis.

    Thanks for the wonderful site


  16. Posted by meeraghu on April 19, 2008 at 3:37 pm

    Hi Lakshmi,
    Thanks for your comments. Yes, I do want to add lyrics as much as possible, it takes a lot of time, and I am in a bit of time crunch right now.


  17. Posted by megha on May 19, 2008 at 9:46 pm

    Do u have kannada song “jaya mangalam nitya shubha mangalam”, “mangalruti tandu belaguve ambujakshana ranige”, “mangal bharatiyage, mangal raghav priyage, mangal shri krishanane bhakutige…”

    i’m not too sure about the 3rd song..i know the rhythm but dont know the words…these songs are normally sung during kapur arti or on friday poojas…

    will be great if u can upload on ur site or email them to me.

    appreciate ur help and hard work.



  18. Posted by meeraghu on May 22, 2008 at 8:04 am

    Yes, Megha. I do have them. I will post them.


  19. Posted by gayathri on May 28, 2008 at 6:12 am


    I am eagerly awaiting your reply regarding the lyrics for “mangalruti tandu belaguve ambujakshana ranige”, as requested for earlier by megha.

    I could not find the upload – hence am adding my comment. Great work – keep it up!




  20. Posted by meeraghu on May 28, 2008 at 6:43 am

    Hi gayathri,
    Yes, I have it in my book, I just need to find time to translate it to English. I will try to add it as soon as possible. Thanks for your patience.


  21. Hello!
    I was looking for the lyrics for “Lambodara Lakumikara”- the classical music version that is taught across Karnataka as “Geethegalu”!
    I came across ur site and immediately added to my favs! Fantastic site and fabulous work you are doing here! I am a great fan of Sri. Vidyashushana Swamiji. His voice brings joy to the soul! If you have any lyrics of his songs they also would be a pleasure!
    May God Bless you! All the best!Please do mail me the lyrics when you find time! Thanks love Sujyothi


  22. Posted by meeraghu on May 30, 2008 at 6:15 am

    Hi Sujyothi,
    Thanks for your nice comments. The lyrics for “lambodara” is in this page itself. Here is the link:


  23. Posted by Gururajan on June 11, 2008 at 8:27 am

    Contents are appreciative and appealing. Carry on the great work. I wish that lyrics with meanings of Sri Raghavendra Stothra of Appanachaar and Sri Guruguna Sthavana by Sri 1008 Sri Vadheendhra Theertha is a must have in your blog.


    Gururajan C.K.


  24. Posted by Gururajan on June 11, 2008 at 8:34 am

    Respected Meera Subbarao,

    Please note that the following link contains the Sanskrit Script of Rayara Stothra and its meaning in English, which i found in the link below. I think you can post the link in your lyrics section(if you feel that it would add value) to your blog.

    Gururajan C.K.


  25. Posted by meeraghu on June 11, 2008 at 6:55 pm

    Sri Gururajan,
    I have added links to the pdf in the Sri Raghavendra Stotra post as well as this page. Thanks so much for the link. I really appreciate your efforts. I have also added a new post just for the translation.


  26. Posted by Ana on June 13, 2008 at 2:44 pm

    Dear friends,

    I would be really grateful if someone can help me to find the lyrics for the songs performed by Mahalakshmi Suprabhatham-Kavasam on her CD (sorry, can’t even read the name of CD :). These are the devotional Lakshmi songs that I would really like to learn. E.g. Adhi Lakshmi Namasthe (Sri Maha Lakshmi Stuthi), Sri Ashta Lakshmi (Sri Mansavanditha Sindhari), Sri Ashta Lakshmi Kavasam, and others. I’m quite new with Indian devotional music and need some guidance, please. I can provide more info I someone would be so kind to help. Thank you very much in advance!


  27. Posted by meeraghu on June 13, 2008 at 6:58 pm

    Hi Ana,
    Here is a pdf link for the astaalaksmi stotram. I am not able to find lyrics for the others in English. I do have the books for these in Kananda, my language.

    Also, here is a link for the pdf’s for all devi stotrams.


  28. Posted by Ana on June 21, 2008 at 3:35 pm

    Thank you, Meeraghu! Well, seems what she sings is not there… But her voice is so so beautiful, clear and joyful. Gives a very nice feeling. I wonder in what language she sings. I know very little Bengali, but not sure if she sings Bengali. Anyway, thanks for your help. I guess I’ll just try to make notes as to how I hear and sing along 🙂


  29. Posted by Ms. Surya Ananthasivan on June 22, 2008 at 6:32 am

    Dear Devotees

    i need Hanuman Chalisa and all Hindu Slokas in Malayalam script.
    Can anybody help me or tell me where can i find it?



  30. Posted by savitha on June 28, 2008 at 4:06 am

    Dear Devotees
    I need Hanuman chalisa in Kannada script. Can anybody help me, wher can I search?



  31. Posted by C J Madhu Sudhan on July 2, 2008 at 3:21 am

    Really Impressive website for us, Pls try to locate more Slokas and Mantras of Lord Maha Vishnu and Hunmath keerthana and Nava Brindavana Swami’s Slokas.


  32. HI Savitha ,
    Please go thru the link for kannada Hanuman Chaalisa,
    Mail me if u need the pdf version

    Jai Hanuman


  33. Posted by Sheethal Shankar on July 10, 2008 at 1:40 am


    Please please can any help me in getting the lyrics for Aarti’s for Lakshmi devi. Like Adhi Lakshmi devi ge aarthi ya…
    I will be greatful to you



  34. Hello,

    Try this link for sloka for kids
    Very informative and interesting for Kids.



  35. Posted by Vijay B Rao on July 30, 2008 at 12:10 pm

    Hi to all, i am rely thank to the Provider of this site, its rely wonderful,
    i am looking for some Kannda bhajans, if u have any please let me know,


  36. Posted by Prakash on August 1, 2008 at 3:38 am

    Very good collection.I am impressed. I am looking for Yellama devi (Renuka) arthi


  37. Posted by Narayan Kashyap on August 4, 2008 at 6:27 pm


    Great site for Madhwa’s and others as well. Good Job, keep going!

    Do you have the lyrics for ‘ Amba Paalise, Jagadaambe Nee Yennna Amba Palise..
    Kashiyalli Iruvole … Doshava …..



  38. Posted by Anupama on August 5, 2008 at 1:56 am

    Hi Meera,

    I am Anupama from Bijapur.WHere are you now?How are you? How many kids do you have.Do you have adhi lakshmi devige aratiya yettire lurics?



  39. Posted by meeraghu on August 5, 2008 at 8:00 am

    Hi Anupama,
    I am staying in Maryland, USA from the past 7 and 1/2 years. I have one daughter who just turned 16 last week. Where are you? How are you all? How is Nirupama doing?

    I have several books, I will look at those and let you know if I have the lyrics.

    Nice meeting you after so many years.


  40. […] have added several lyrics on Shri Raghavendra Swamy in this blog, you can look for those at the lyrics page, or click on the Shri Raghavendra Swamy categories section and you will be listed with several […]


  41. Posted by prasad on August 16, 2008 at 12:44 am

    I am trying to trace original Kannada script for the popular Vyasaraja song Krishna Nee Begane Baaro. There are multiple versions in English posted on the Web and all of them seem to have one or the other words wrong.

    One in
    is almost right except for the charanam2 where vajayantimaalE should have been vaijayantimaalE. The word mayyOLagamma in charanam3 is where most confusion comes: while mayyOLagamma is right word, does not fit the sentence well.

    Other versions at and your own website also seem to have many wrong kannada words, such as, Odiyalli, Ongura.

    Has anyone located the original script written by Vyasaraja? Leaf or copper plate?

    pls help me.



  42. Posted by Geetha Ratna on August 17, 2008 at 2:21 am

    Hello Madam,

    I was looking for some details on Raghavendra Swamy Mutts in Hyderabad and I happened to visit your site.

    The site is very interesting and provides good information for Madhwa community.

    All the very best for your services,



  43. Posted by meeraghu on August 17, 2008 at 8:56 am

    Thanks Geetha. I am looking for the lyrics you have asked, I will post if I find them.


  44. Posted by Neeta on August 18, 2008 at 8:56 am

    Hi Meeraghu,

    Do u have kannada song “jaya mangala nitya shubha mangala”, “mangalruti tandu belaguve ambujakshana ranige”, “mangal bharatiyage, mangal raghav priyage, mangal shri krishanane bhakutige…”. If u have please email me or upload it on your site.

    Thanks for all your efforts. Your website is very heplful.



  45. Posted by meeraghu on August 18, 2008 at 9:03 am

    I have almost all the songs you have asked except for “mangalruti tandu belaguve ambujakshana ranige”. I asked my Mom and my Grandmother as well. Everyone has misplaced the book they had. I will try to get it.

    However, I do have the lyrics for all the other songs you have asked. I will post them.


  46. Posted by meeraghu on August 19, 2008 at 11:01 am

    Hi Prasad,
    The main reason being different versions as far as I know is the script. I have learnt Kannada, but not writing Kannada in English; which I do here to assist people who don’t know Kannada. So, there are mistakes bound to happen. I usually add lyrics images as well to make it clear. In this case, I will capture a screen shot and post it so that it helps.

    I hope you are now able to appreciate why there are different words for the same song.


  47. Posted by pratibha on August 22, 2008 at 4:09 pm

    Thank you so much for the lyrics. I googled the exact date for Janmashtami this year and found your site. I am so glad I found it. It was helpful.


  48. Posted by GSankarG on August 24, 2008 at 2:10 am


    I want Raghavendra Slokas in Tamil / English Lyrics

    If any of Noble Hearts are having Please send to my email ID


    – Om Shakthi Om
    G Sankar G


  49. Posted by rashmi on August 25, 2008 at 9:53 am

    i want the lyrics or site to find lyrics of rudra abhisheka if anyone knows pls help in finding it. mail me


  50. Posted by Anitha on September 5, 2008 at 9:15 am

    Hello Meera Avare,

    I was told about your blog by my uncle, and I am hooked on to it ever since. I must say you have done a very good job.

    I was looking for the lyrics of “Baro Guru Raghavendra” in devanagiri. If you have it, please mail it to me or post it on this link.

    Thanks a lot, and keep up the good work!


  51. Posted by meeraghu on September 5, 2008 at 10:08 am

    Hi Anitha,
    Thanks so much for you nice comments. Thank your Uncle also on my behalf. Yes, I do have the lyrics for “Baro Guru Raghavendra”. I will post it.


    • Posted by Venkatesh on October 3, 2011 at 5:32 pm

      Kindly let me know if anyone has the kannada lyrics for “Jaya Janardhana Krishna Radhika Pathe”.



  52. Posted by Roopa on September 8, 2008 at 12:10 pm

    Hi Meera,
    No words to thank u for posting the lyrics n songs. Can u pls post some more songs n lyrics of aarti n Raghavendra swami.


  53. Posted by meeraghu on September 8, 2008 at 1:00 pm

    Thanks, Roopa. I am not sure which song you are referring to for aarti?


  54. hi..
    great work..Awesome stuff…keep it up..can you please post “Hari Vayu Stuti” in tamil script…


  55. Posted by gauri on September 20, 2008 at 7:19 pm


    This is a great site…and u have done a wonderful job.can u post the below slokam in malayalam script.

    (Saraswathi Namasthubyam
    Varade Kamaroopini
    Vidya Aarambam Karishyami
    Siddhir Bhavatume Sada)

    thanks in advance…


  56. Posted by meeraghu on September 21, 2008 at 7:26 am

    Hi Venkatesh, Gauri,
    Since I don’t know Tamil or Malayalam, I am unable to get any slokas in these languages. Download Baraha, and also the baraha scripts I have posted. You can than convert into your native languages.


  57. Posted by ArchanaUpadhyaya on September 23, 2008 at 11:17 am

    hi meera
    thanks for this wonderful blog of yours.wonderful work done by u.thru this all our madhwa community should be proud of u.keep going.found lots of useful things.just one request.kindly post me Shri vadirajakavacham in sanskrit.
    anyways all the best for ur future projects.


    • Posted by Veena Joshi on July 26, 2011 at 12:34 am

      Hi Meera,

      Can you please post English Version of Banashankari (Shakambari) Kavacham on this site please.
      Banashankari is our home goddess after marriage and I am finding it difficult to memorise this Kavacham.

      Veena Joshi


  58. Posted by Dr Narendra P on September 29, 2008 at 6:09 am

    Hi I require Hanuman Chalisa in kannada Can any one help me on this


  59. Posted by bhaminirao on October 2, 2008 at 1:15 pm

    Im looking for the audio of “Srinivasa Kalayana” composed by Sri Vadirajaru in Kannada. The first line is ” Stri yellaru Bannire, Srinivasa Padire” I have the lyrics of it. If you could help me with audio, it would be wonderful.


  60. Posted by meeraghu on October 2, 2008 at 1:50 pm

    Did you check in Most links I have provided are from that web site.


  61. Posted by Rajagopal on October 3, 2008 at 10:14 am

    can i get the lyrics of Mahisasura Mardini & Navagraha Stotra


  62. Posted by meeraghu on October 3, 2008 at 10:21 am

    Mahisasura Mardini stotra has already been posted. I will post the Navagraha Stotra when I get time.

    Here is the link:


  63. Posted by bhaminirao on October 3, 2008 at 1:24 pm

    Yes, I checked kannada audio, Lakshmi Shobane is there, but unable to find Srinivasa Kalayna. Im asking for this is becaz, it is very auspisious when you chant during Navaratri.


  64. Posted by meeraghu on October 3, 2008 at 5:43 pm

    I have heard my Mom and grandmother sing this, I am just unable to recollect the tune.


  65. Posted by bhaminirao on October 6, 2008 at 6:06 pm

    Could be, caz its mostly sung in all the Madhwa house. If I come across the song, will, surely let you know, so that you can update it. Thanks for trying.. 🙂


  66. Posted by Roopa on October 16, 2008 at 9:27 pm

    do u ahve YANTRODHARAKA STOTRA of pranadevaru… edu vyasarayaru barediddu.. hampi pranadevara mele…. i need it in kannada …
    if u have plz post it… thanks in advance


  67. Posted by meeraghu on October 17, 2008 at 6:56 am

    I do have many books, will check it and keep you posted here.


  68. Posted by Anita Sreenath on October 18, 2008 at 10:33 am

    I have no url Kindly post the sYantrodaraka storans by return mail


  69. Posted by Gayatri on October 24, 2008 at 5:01 am

    Hi Megha,
    Ur website is great..which gives lot of information.
    Do u have lyrics of the song-Kalyana Rupaya Kalaujananam.Kalyana datre karuna sutapte..kambadi divyayuta shaktaraya..vatalayadish namo namaste
    Narayana(16 times)



  70. Posted by meeraghu on October 24, 2008 at 7:03 am

    Thanks Gayatri,
    My name is Meera, not Megha. I am not sure I have those lyrics.


  71. Posted by Sravanti on October 24, 2008 at 9:51 pm

    Thank you so much for having such useful information up on here. Could you please put up the lyrics for “Poojayu madanu baa Lakshmidevi pada kamalage”


  72. Posted by kamakshi srivatsa on November 6, 2008 at 10:21 am

    great effort!! can you please help me with the lyrics of ‘murali bariso maadhava’ ಮುರಳಿ ಬಾರಿಸೋ ಮಾಧವ!! written by pujya sri sosale swamyji? thnx for providing lyrics of ‘venkatachala nilayam’. it is my all time favourite!!


  73. Posted by veena on November 12, 2008 at 6:10 am

    Hi Meera,

    Very useful blog.Can u post more aarthi songs with audio so that we can listen and practise.



  74. Posted by Ganga on November 22, 2008 at 12:20 pm

    Hello Meera,

    Could you please mail me the kannada lyrics of Hanuman Chalisa. I tried downloading from this link –
    but there seems to be some problem, the page itself does not get opened .

    So, please e- mail me the kannada lyrics of Hanuman Chalisa.

    Thnak you,

    Ganga ( Smile)


  75. Posted by ramya on December 11, 2008 at 11:52 am

    im learning keyboard now ….can i haev the lyrics of
    kunda gauri gaura
    kerayani iravu songs…

    Ramya, I am not sure I have heard these songs.


  76. Posted by Nandhini on December 11, 2008 at 8:37 pm

    Hi Meera,

    This is a very useful blog. Meera i dont know the procedure to fast,pryer on Thursday(Guru Rayaru) and Ekadhsi . Can you please tell me how to do these fasting? Since I have herniated disc problem , i cannot do namaskram. Please let me know about these.

    Sure, Nandhini. I will let you know.


  77. Posted by Sreedevi on December 20, 2008 at 5:24 am

    I would be really grateful if someone can help me to find the lyrics for the Shree Hanuman chalisa in malayalam. Recently I read somewhere, reciting this, will help you to obtain your dream job. I am a jobseeker for the last 2 years, but …….. Can u suggest me a sloka which will help me to obtain my goal. Expecting an early reply from ur side.


  78. Posted by Geeta Vedanti on December 26, 2008 at 5:24 pm

    I am glad i found this website. I starve for kannada bhajane lyrics. Does somebody has lyrics for Neela Lohita Damaruga Trishula Shobhita, Nandi Vahana…………….. . Thanks in advnace


  79. Posted by M.C.shetty on December 26, 2008 at 10:53 pm


    I need Sri Krishna Mangalam lyrics in Kannada. Could you please suggest a link?


  80. Dear Meera

    Congrats for your commendable job! I am a kannadiga, and since two generation my people are settled in gujarat. i was surfing the net in order to get complete lyrics of ‘jo jo Shri Krishna Paramanada’ and my happiness knew no bounds to see this web-site. Actually, i am doing a research assignment on Kannada Lullaby. Do do know some? Do reply, I have collected quite a few already from my grandmother’s relations living in karnataka.
    If you know about the song, “Jo chinna, jo ranna, jo jo…” it would be great, i dont know it fully.
    thanks again


    Shweta, Thanks so much for you comments. I have a few songs written by Shri Purandara Dasaru. I will post them


  81. ಮೀರಗೆ ನಮಸ್ಕಾರ,
    ನಿಮ್ಮ WordPress ತುಂಬಾನೆ ಚನ್ನಾಗಿ ಮೂಡಿಬಂದಿದೆ, ಸಾದ್ಯವಾದರೆ ಕ್ಲಾಸಿಫೈ ಮಾಡಿದರೆ ಇನ್ನು ಚನ್ನಾಗಿ ಕಾಣಿಸುತ್ತೆ ಹಾಗೂ ಹಾಡು ಹೊಡುಕೊಕೆ ಅನಕೂಲ ಕೂಡ.


    Atmananda Mallappa
    melbourne ,Australia

    Thanks for your suggestion, Atmananda. I will see what I can do for the same.


  82. Posted by Triveni on January 8, 2009 at 6:56 am


    Thank for all devotional songs, I need Lyrics of Durga Suprabhatha


    Triveni, I will see if I have the lyrics.


  83. Posted by Satish on January 12, 2009 at 10:46 pm


    Congratulation’s on such a wonderful web site with Lyrics. Those of us who live overseas this is an oasis. I am looking for the lyrics of the song sung by Pdt Bhimsen Joshi ” Naa ninna dhyan dol iralu sada” I think it is a Purnadara Dasa Bhajan. If any one could help, would be much obliged. If there is site where I can hear it or download it I can write them. Thank you so much.


  84. Posted by Rudresh on January 21, 2009 at 12:14 am

    Thank you very much for the wonderful web site with Lyrics.

    I am looking for the lyrics of any song, sung for Lord Subramanya. please can you suggest a link.


  85. Posted by Rajeev on February 5, 2009 at 3:57 am

    Hi Meera,

    Have u got lyrics for song “Intha rangayyagenendu manasote” and “Ivanentha balavantano kuntiya sootano”. If u have them can u post them on this website at the earliest. Thanks in advance.


    Rajeev, Any idea who has composed these songs?


    • Posted by Rajeev on November 23, 2009 at 4:14 am

      can u plz look into this website, I think they have lyrics in this webpage. But dont have access to it from my office :(.

      It wud be of great help if u could get the lyrics and put it in your website.



      • Posted by meeraghu on November 23, 2009 at 8:54 am

        I was able to look into the website. However, I don’t think I can copy and post it here. I need their permission, and I don’t know the poster there, nor am I a member of that message board. Sorry about that.

    • Posted by rajeev on December 3, 2009 at 2:01 am

      Hi Meera,

      I am abe to access that link but am unable too see the attachments. Can u plz reply me with the corect URL wherein u were ale to c lyrics of this song.


    • Posted by Rajeev on December 28, 2009 at 6:29 am

      Hi Meera,

      I wanted complete “Devara pooje vidhana”. Do you have it? If its in Kannada (especially the mantras), it would be of great help. I have posted the same request in some other section also (sorry for duplication).

      Thanks and Regards,


  86. Posted by Shyla on February 9, 2009 at 5:06 am

    Hi Meera,

    Thanks so much for this site.
    Wud u have the Navagraha strotra with you? if yes then can u pls post it…thanks again


  87. Hope you have posted Hari Kathamruta Sara. Thanks


  88. Posted by Pralhad Rajpurohit on February 21, 2009 at 12:33 am

    Woderful site with rich information on devotional songs.

    By the way thanks for the lyrics of “Thunga Teeradi Ninta Suyativara”…


  89. Posted by Nandan on March 4, 2009 at 9:43 am

    Its a great job. I have some more collections which i have done using baraha on MS word. If you give me your mail id i shall send it to you. So that it will be usefull for most of the people

    Sure. Thanks so much.


  90. Posted by Rohini on March 5, 2009 at 3:46 am

    Great collections. Thanks alot for this “one stop” devotional site. Can you please upload any video/audio for dasavathara mangalam (jaya mangalam /makutake by Purandara daasar)


  91. Posted by Nandan on March 9, 2009 at 7:18 am

    I sent 2 songs Lyrics to your mail id. Let me know if you could open it so that i am sure that you can open the attachments.


  92. Posted by Nandan on March 13, 2009 at 4:54 pm

    Hare Sreenivasa,
    the link for Aaruti belagire & tulasi stotra are not working. Request you to have a look at it.

    Yes, Nandan. I will correct them.


  93. Posted by Krishna K V on March 17, 2009 at 1:26 am

    There is a song of Purandara Dasa which begins as below:

    “Ashtami ardha ratriyalli janiside
    Dushta Kamsanu haakida baagila tegeside”

    Would be very greatful if you could help me get the full lyrics of this song. Thanks!!

    I am not sure I have the song, but let me check.


  94. Posted by Chandrika on March 18, 2009 at 7:43 am

    Pls update Rajkumar’s Vaara Banthamma Guruvaara Banthamma Lyrics in English. Waiting for it.

    Yes, I will chandrika.


  95. Posted by Chandrika on March 20, 2009 at 3:54 am

    Hi Meera,

    I found lot of songs, its lyrics and info, which r very useful to me. Thx for the uesful blog….but pls do post the lyrics simultaneously in English, there are few kannadigas like me, born and brought up in other states, tough to read/write in Kannada.

    I wish u all the best to continue ur work!

    Chandrika Anand

    I agree. I try as much to post in English as well. Due to time constraints, some are just in Kannada.


  96. Posted by chaitra P shetty on March 22, 2009 at 2:36 am

    Hi Meera,
    I found ur blog to be very useful.
    please cud u mail me Lyrics of Hanuman chalisa in Kannada script.

    Chaitra Prahalad Shetty

    Chaitra , it has been posted in the blog. Look in the Lyrics page. Sri Hanuman Chalisa in Kannada.


  97. Posted by Maya Desai on March 25, 2009 at 1:32 am

    Dear Meera,
    Its a wonderful site especially all information in one site- A great one indeed.
    I had been looking for lyrics of some songs, most of which i could easily get in this site.
    I am still searching the lyrics of the following:

    1) devi song:
    “varava kodu thai varava kodu,
    B agalage torana , madave munjve namakarna, maduvanta varakodu thai varava kodu..

    I have forgotten inbetween lines too..

    2) Satyanarayana Arti song
    ” jaya jaya stayanarayana jaya jaya laxmi ramana jaya jaya”

    I have the first one, will look for the others as well.


  98. Posted by Maya Desai on March 25, 2009 at 2:01 am

    Hare Shrinivasa.

    Dear Meera,

    Its a wonderful site especially all information in one place- A great work indeed.
    I had been looking for lyrics of some songs, most of which i could easily get in this site.
    I am still searching the lyrics of the following:

    1) devi song:
    “varava kodu thai varava kodu,
    Bagalage torana , madave munjve namakarna, maduvanta varakodu thai varava kodu..

    I have forgotten in between lines too..

    2) Satyanarayana Arti song
    ” jaya jaya stayanarayana jaya jaya laxmi ramana jaya jaya”

    3) Eswhar mangarti song :

    “mangala jaya girija ramana mangala. mangaruthi …..
    jata mukuta gange dharise
    spatikaa de tri netrana “.

    4) one more song
    “tappu galayella vapikollu namappa kayo thimappa nine……
    bisilu mali gali chali walage….desha tirige…….”

    If you have the lyrics of these songs in english, kindly send it to me or you can upload the same in the site.

    Sure, Maya. Thanks for you wonderful comments.


  99. Posted by trmuralidhar on March 26, 2009 at 5:58 am

    Hi Meera Ji

    Ur Blog is very informative especially the lyrics of Dasara Padagalu. Almost all the songs r there, few thing which r not with me are in kannada.Could u please try to post it in English or Sanskrit.

    One more song it goes like this Muttina Unngura Kotta Rama Hanumage… Please post that lyrics if you find that. Its a request.
    Thx a Lot

    Sure, Muralidhar.


  100. Posted by Amit on April 10, 2009 at 4:54 am

    hi all,

    Really its wonderful site.

    i was looking for the following songs pls send me if u get,

    sathatha margadi santhatha seviparige, rathavanerida raghavendra,

    thugire rayara thugire gurugal thugire yadakula tilakara.

    Amit, both these songs have been posted in this blog. Please check the lyrics page.


  101. Posted by narayan vadeyar on April 16, 2009 at 8:00 am

    pls note my new email ID . continue good work in future too


  102. Posted by trmuralidhar on May 6, 2009 at 5:30 am

    Hi Meera Ji

    One more dasara pada, u must have heard it, by listening I have transalted the entire song lyrics in English. I would like to forward it to you all.

    Udupi Krishna Odavi Godaya Bhidadheninna Adigereguve (2)
    Kaadalasayana Badavarannu Bhidadhe Poreva Mridanasakane (2)

    Udupi Krishna Odavi Godaya Bhidadheninna Adigereguve (2)

    Naari Janara Seeresaladhu Eerimarava Thorathanadhi (2)
    Seeregalaanu suregondi Marajanaka Varijhaksha (2)

    Udupi Krishna Odavi Godaya Bhidadheninna Adigereguve (2)

    Aashtamatadha yathigallindha Estapujekolluthiruvi(2)
    Krishnaraya ninna Mahime Yetshupogalaluninnu naanu (2)

    Krishna OdaviUdupi Godaya Bhidadheninna Adigereguve (2)

    Kanasinalli Manasinalli Nenevatheradhi Manavannithu (2)
    Hanumanaiya Palisenna Ninagesariya Eendhu Jhagadhi (2)

    Udupi Krishna Odavi Godaya Bhidadheninna Adigereguve (2)
    Kaadalasayana Badavarannu Bhidadhe Poreva Mridanasakane (2)

    This song I heard it in, sung by Vidyabhushana. When u hear the song it is really melodious.
    Thx & Rgds
    Muralidhar T.R.


    • Posted by meeraghu on May 6, 2009 at 3:44 pm

      Thanks so much, Muralidhar. I will try to find the Kannada translation and post it on the main page. Thanks again.


  103. Posted by trmuralidhar on May 7, 2009 at 3:52 am

    Hi Thank you,
    URL is as follows,in this u can listen to the song.

    Thanks, Muralidhar.


  104. Posted by Amit on May 12, 2009 at 11:28 am


    could anybody can get me lyrics of song “DASANAGU VISHESHANAGU”
    sung by p.n


  105. Posted by pushpa on May 13, 2009 at 4:26 am

    hi meera….
    i am searching for the lyrics of “kamalada mogadavale kamalada kannavale kamala kai ali ididavalu” which is from a movie in which jayamla has done. plz… send it to my e-mail if u get it plz………

    Pushpa, who has written this lyrics? Is it Shri Purandara Dasaru?


  106. Posted by gayathri on May 13, 2009 at 5:02 pm

    hi amit i have dasanagu song lyrics with me ..


    • Posted by Amit on May 14, 2009 at 12:44 am

      Hello gayatri,

      Could you please send me the lyrics of dasanagu to my e-mail?

      else u can post in this page.
      @meera : please post this song in lyrics page after u get from gayatri.
      THANK YOU.

      Amit, yes of course. Any thing related to this blog, you all can share with me and I will post them.


  107. Posted by Amit on May 18, 2009 at 12:54 am

    Hello meera ji,

    I have got the lyrics for one of the beautiful song sung by p.n

    ||hyange madallaya krishna hogutide aiyushya||
    mangalanga bhava bhanga bidisi ninna dingarigana mado ananga janaka||

    Esu janumada sukrutada phalavo tanu janisalagi
    bhusura dehada janumavu enage sambaviside agi

    moda theertha matha chinhitha nagade doshake volagagi
    lesha sadhanava kanade dussahavas dindale dina dina kalede ||

    shashi mukha kanakada ashege beretu vasupati nin adiya
    hasanagi ninna neneyade krupeya galisade kettenayya

    nishe hagalu sthiravendu tanuvanu poshisilashisdiya
    kusuride nelavo sarva kala ninodetana vembuva bageyanu ariyade||

    nerenambida paavatigalu ella saridu hodavalla
    marali epari janumavu baruva bharavase antu illa

    pari pari vishayada asheyu enage hiridu aitalla
    hariye jagadi ne obbanallade porevarinnaru illa valla||

    avani olage punya khetra chalisuva havanike enagilla
    pavanatmaka guru madhawa shastrada pravachana kelalilla

    tavakadinda guru hiriayara sevisi avara olisalilla
    ravinandana kelidaruttara kode vivara saraku ondadarilla||

    bhagavthara odagudi upavasa jagar ondina madalilla
    ragadi shuka muni pelda hari kathe samyoga vembudilla

    neeguvanthe bhava bahayava bhakuti vyaragya vembudilla

    yogi vandya gopala vittala , vittala vittala gopala vittala
    tale baagi ninnane bedikombe….

    ||hyange madallaya krishna hogutide aiyushya||
    mangalanga bhava bhanga bidisi ninna dingarigana mado ananga janaka||


  108. Posted by Triveni on May 20, 2009 at 5:45 am

    Hello Team,

    Please can any one help me in getting the lyrics for “Dheera Gambheera” song lyrics of Katyayani Mangalam

    Thanks & regards


  109. Posted by Subbarao on May 22, 2009 at 3:13 pm


    UR site is very good . I am from tamilnadu. I Need to know the Meaning Of my name did U know that .If U know please mail to me

    Subbarao R


  110. Posted by bheema on June 7, 2009 at 10:35 am

    one of the bhajans I had memorized when I was a kid , I’m 51 now …I could never get past after a few lines and it was highly intimidating & it was haunting me all these days… I have been trying for years now…couldn’t find it any publishings..
    clear sign of deterioration of culture.
    I can get back my routine now… many thanks

    Did you find the lyrics for the Bhajan you were searching?


  111. Posted by kala on June 9, 2009 at 6:19 am

    Namaste Meera Ji,
    Your site is very good, i am from Bangalore, I have almost all the lyrics which is posted on the site.

    Can you get the some songs which brahmins sing during the wedding or mudan or during aarthis.

    Kindly post the lyrics both in Kannada and English.


    Namaste Kala Ji, I have posted several aarathi songs which are sung during wedding, festivals, on Fridays. Sure will post the others as well.


  112. Posted by MANJUNATH on June 12, 2009 at 2:21 pm

    very good site for kannadigas, very good collection and greate work

    Thanks, Manjunath.


  113. Posted by MANJUNATH on June 12, 2009 at 2:22 pm

    good work and good dedication


  114. Posted by SREEDEVI on June 22, 2009 at 10:56 am

    hi meera, nice to see a oceanof ny unequalled , unparred treasures here. do you know the lyrics of
    ‘nadhedhu baramma manege varamakshmi neenu”. thank in advance.

    I haven’t heard this song Sreedevi.


  115. Posted by Sreedevi on June 22, 2009 at 3:32 pm

    thanks Meera for quick reply. Can you post more songs on lakshmi and krishna.

    Hi Sreedevi, many songs on Lakshmi and Krishna are posted. Take a look at the lyrics page for an alphabetical list of all the songs.


  116. Posted by Suresh on June 24, 2009 at 1:32 am

    Do you have the lyrics or wordings of Neela Saraswathi Sthotra??? is yes please mail across the link or the same to



    No, Suresh. I don’t have.


  117. Posted by vinatha rao on June 24, 2009 at 6:19 am

    Hi Meera,
    I was looking for some songs for my grandaughter and came to see ur site.Thanks for the wonderful collection and easy listening.It has all the important songs and lyrics..great job.

    Hi Vinatha, Thanks so much for you comments.


  118. Posted by Hiren Trivedi on June 25, 2009 at 4:53 am

    Hi Meera,

    While I was searching the gayatri mantra written in Gujarati text, I came along your site. The work done by you is incredible.

    Can you please provide Gayatri mantra written in Gujarati text to my e-mail address. I need it very urgently.

    Thanks for your support.

    Hi Hiren, I don’t have the mantra in soft copy and neither do I know Gujarati. Sorry.


  119. Posted by Nagu Rao on July 4, 2009 at 7:17 am

    Dear Meera,

    As Purnima is on the 7th of July, I thought of sending my own composition of Sri Sathyanarayana Katha that can be sung in a minute. This contains all the seven chapters and complete. I would appreciate if you can publish this on your site. Here is the lyrics of the cpmpostion:

    Sathyanarayana Katha

    Composer – Nagu
    Pen Name – Naganandini

    Prati Hunnimeyandu Poojeya Maadi
    Sri Sathyadevara Mahimeya Paadi

    Naimisharanyada Rishigalu kelalu
    Premadim Sutaroo Naradage Helida Sathya |1|

    Sathyesha Pratthyaksha Kashiyaa Viprage
    Tilisidana Uttamage Aruhidaa Sathya |2|

    Ulkamukha Rajadampatiyaru Putriya Padedu
    Vartakage Kathehelida Sathya |3|

    Maretha Vratavanu Kanye Kshamisendu
    Aacharise mannisi Mangalavittu Poredanta Sathya |4|

    Sanyasi Roopadim Naveli Shodisi
    Bhodisi Dhanavittu Harasida Sathya |5|

    Kuvari Aadaradi Bedalu Ambaradi
    Anugrahisi Pati Pitara Ulisida Sathya |6|

    Thugadwajanu Tirugi Naivedya Sevisalu
    Sanga Sukhavittu Salahida Sathya |7|

    Jagarookadi Nithya Jeevanadalli Sathya Devara Bhajisi
    Naganandiya Bhakti Shaktiya Rakshe Rarajisi

    Prati Hunnimeyandu Poojeya maadi
    Sri Sathyadevara Mahimeya Paadi

    I have posted this and Nithyanandavittala’s version also on the you tube.
    The links to these are:

    With love and best wishes,


    Thanks Nagu. I am a bit confused. Who has composed this song?


  120. Posted by reghulal on July 11, 2009 at 11:48 pm


    Thank you so much for all your efforts. Kindly let me know how to get the malayalam version of alll these slokams.



    I don’t know Malayalam. So, please forgive me.


  121. Posted by Veena on July 13, 2009 at 3:58 am

    please post me Kapadu shri Satyanarayana song lyrics….


    Veena, I don’t think I have the lyrics. But, will try to find and post the same.


  122. Posted by ನಾಗೇಶ್ ಕುಮಾರ್ on July 20, 2009 at 12:13 pm

    ಗೆಳೆಯ ಗೆಳತಿಯರೆ,

    ನಿಮಗೆ ಬೇಕಾದ ಹಾಡಿನ ಸಾಹಿತ್ಯ ಇಲ್ಲಿದೆ ..ಓದಿ…ಕನ್ನಡ ಓದಕ್ಕೆ ಬರತ್ತೆ ತಾನೆ?

    ಸತ್ಯಾತ್ಮ ಸತ್ಯ ಕಾಮ ಸತ್ಯ ರೂಪ ಸತ್ಯ ಸಂಕಲ್ಪ
    ಸತ್ಯ ದೇವ ಸತ್ಯ ಪೂರ್ಣ ಸತ್ಯಾನಂದ

    ಕಾಪಾಡು ಶ್ರೀ ಸತ್ಯನಾರಾಯಣ
    ಪನ್ನಗ ಶಯನ ಪಾವನ ಚರಣ
    ನಂಬಿಹೆ ನಿನ್ನ

    ನಾರಾಯಣ ಲಕ್ಷ್ಮಿನಾರಾಯಣ
    ನಾರಾಯಣ ಸತ್ಯನಾರಾಯಣ

    ಮನವೆಂಬ ಮಂಟಪ ಬೆಳಕಾಗಿದೆ
    ಹರಿನಾಮದಾ ಮಂತ್ರವೇ ತುಂಬಿದೆ
    ಎಂದೆಂದು ಸ್ತಿರವಾಗಿ ನೀನಿಲ್ಲಿರು
    ನನ್ನಲ್ಲಿ ಒಂದಾಗಿ ಉಸಿರಾಗಿರು

    ನನಗಾಗಿ ಏನನ್ನು ನಾ ಬೇಡೆನು
    ಧನಕನಕ ಬೇಕೆಂದು ನಾ ಕೇಳೆನು
    ಈ ಮನೆಯು ನೀನಿಇರುವ ಗುಡಿಯಾಗಲಿ
    ಸುಖ ಶಾಂತಿ ನೆಮ್ಮದಿಯ ನೆಲೆಯಾಗಲಿ

    ಕಣ್ಣೀರ ಅಭಿಷೇಕ ನಾ ಮಾಡಿದೆ
    ಕರುನಾಳು ನೀ ನನ್ನ ಕಾಪಾಡಿದೆ
    ಬರಿದಾದ ಮಡಿಲನ್ನು ನೀ ತುಂಬಿದೆ
    ನಾ ಕಾಣದಾನಂದ ನೀ ನೀಡಿದೆ.

    Nagesh Kumar Avare, Can you send this as a soft copy, so that I can upload the same in the blog. That would help readers from downloading and printing the same as well. Thanks so much again for the lyrics. Appreciate it a lot.


    • Posted by Ngaesh on July 24, 2009 at 10:32 am

      ನಿಮ್ಮ ಕೋರಿಕೆ ಸ್ವಲ್ಪ ಅಚ್ಚರಿ ಮೂಡಿಸಿತು.. You can convert this to PDF bythe following steps:

      1. Copy and Paste and save as word doc…That itself is a softcopy.
      .If thats not enouigh the go to step 2

      2. Use any PDF printer like Cute PDF to print it ito PDF and upload as file from Media> add new file and give its URL..Thats how it works in WordPress blog

      Thats what I would have to do too…
      ಸುಲಭ ಅಲ್ಲವೆ?



    • Posted by Dhananjay Jog on August 27, 2012 at 7:38 am

      Kindly send “Tunga teeradi nint suyatiwara ” in Devnagari script. Thanks!


    • Posted by Manu on September 5, 2013 at 4:20 pm

      can u please help me with mahadeshwara daya barade kannada song lyrics and vaara banthamma guruvara banthamma lyrics to my email id


      • Posted by meeraghu on September 5, 2013 at 4:46 pm

        No personal emails. Please subscribe and you will receive an email when the lyrics are posted.

  123. Posted by seema on July 23, 2009 at 9:32 am

    hi meera,

    can you please post “sampat shukravarada haadu” “sampat shanivaarada haadu” ….i have been trying to find it but 😦 couldn’t.


  124. Posted by meeraghu on July 23, 2009 at 9:46 am

    I do have the lyrics in Kannada in a tiny tiny book. Not sure how to post it though. I will try


    • Posted by seema on July 23, 2009 at 1:29 pm


      Seema, the lyrics for Sampat Shukravarada Haadu is posted. I couldn’t scan the one for Shanivarada Haadu. No matter what, they were not legible at all when scanned. Sorry about that.


  125. Posted by Nagesh on July 24, 2009 at 11:08 am

    ಗೆಳೆಯ ಗೆಳತಿಯರೆ,

    ಇದು ನಿಮ್ಮ ಮಾಹಿತಿಗಾಗಿ:

    ಪುರಂದರ ದಾಸ ಮತ್ತು ಇತರ ದಾಸರ ಕೃತಿಗಳ ಭಂಡಾರ ಇಲ್ಲಿದೆ… and click on ದಾಸರ ಪದಗಳು.

    ಇದು ನನ್ನ -ಸೈಟ್ ಅಲ್ಲ.. ! ಹೀಗೆ ಹುಡುಕುವಾಗ ಸಿಕ್ಕಿದ್ದು.


    Thanks for the link.


  126. Posted by trmuralidhar on July 27, 2009 at 4:52 am

    Hi Meera ji

    in the above youtube, sri.satyanarayana vrata katha is really beautiful, I would like to have the lyrics for that. The one which Nagu Rao has given the lyrics is different from the audio version.

    If you happen to get the lyrics please do share with us.
    Thx & Rgds


  127. Posted by meeraghu on July 27, 2009 at 7:05 am

    Muralidhar Ji,
    The above vidoes on youtube are from Nagu Rao. Not sure why there is a mismatch between the lyrics given here and the video posted there.


  128. Posted by T.R.Muralidhar on July 28, 2009 at 1:49 am

    Thx for your response
    Meera Ji


  129. Posted by Pramod Vittal Rao on July 29, 2009 at 6:04 am

    Vandita shesha vandyoru vrundaarakam
    Chandana charchito daara peenaamsakam
    Indira chanchala paangda neerajitam
    Mandarodhari vruttodhbhuja bhoginam
    Preenayamo vasudevam devatha mandala khanda mandanam, preenayamo vasudevam

    Srushti samhara leelavila saatatam
    Pushta shadgunya sad-vigrahollasinam
    Dushta nih shesha samhara kar modhyatam
    Hrushta pushtathi shishta praja samshrayam
    Preenayamo vasudevam devatha mandala khanda mandanam, preenayamo vasudevam

    Unnata prarthitha shesha samsadhakam
    Sannata lowkika nandada sreepadam
    Bhinna karmashaya prani samprerakam
    Tanna kim neti vidvatsu meemaamsitam
    Preenayamo vasudevam devatha mandala khanda mandanam, preenayamo vasudevam

    Vipra mukhyai sada vedava donmukhai
    Supratha paikshiti shaikshvarai-schachitam
    Apra tharkaryorusam vidgunam nirmalam
    Sapraka shajara nandaro pamparam
    Preenayamo vasudevam devatha mandala khanda mandanam, preenayamo vasudevam

    Attyayo yesya kenapi na kwapihi
    Pratyayo yadgune shuthamaa nam parah
    Satya sadkalpa yekovaren yovashi
    Matya noonai sada vedava doditah
    Preenayamo vasudevam devatha mandala khanda mandanam, preenayamo vasudevam

    Pashyatam dukha santana nirmoolanam
    Drushyatam drushyata Mityaje-sharshitam
    Nashyatam dooragam sarvada-pyathmagam
    Vashyatam svecchaya sajjane-shwagatam
    Preenayamo vasudevam devatha mandala khanda mandanam, preenayamo vasudevam

    Agrajam yah sasar jajamagya kruti
    Vigraho yesya sarve guna yevahi
    Ugra aadhyopi yesyatmaja gyathmajah
    Sadgruhi tah sada yah param daivatam
    Preenayamo vasudevam devatha mandala khanda mandanam, preenayamo vasudevam

    Achyuto yogunai nirthya mevakhilai
    prachyuto shesha doshai sada purthitah
    Uchyate sarva vedoruva dairajah
    Svarchite bramha rundraindra purvaih sada
    Preenayamo vasudevam devatha mandala khanda mandanam, preenayamo vasudevam

    Dhaaryate yenah vishvam sada jaadikam
    Vaaryate shesha dukham nijah dhyayinaam
    Paaryate sarva manyainayath paryathe
    Kaaryathe chakilam sarva bhuthai sada
    Preenayamo vasudevam devatha mandala khanda mandanam, preenayamo vasudevam

    Sarva papaniyath samsmruthe samshayam
    Sarvada yanthi bhakthya vishuddatamanaam
    Sarva gurvadi girvana samsthanadah
    Kurvathe karma yat preetaye sajjanah
    Preenayamo vasudevam devatha mandala khanda mandanam, preenayamo vasudevam

    Akshayam karma yasmin pare swarpitham
    Prakshayam yanthi dukkhani yennamatah
    Aksharo yojarahah sarva daivaamrutah
    Kukshigam yesya vikshwam sada jadikam
    Preenayamo vasudevam devatha mandala khanda mandanam, preenayamo vasudevam

    Nandi thirthoru sannamino nandinah
    Sanda danahah sadananda devemateem
    Manda haasaruna paagdadha thonnati
    Vandita shesha devaadi vrindam sada
    Preenayamo vasudevam devatha mandala khanda mandanam, preenayamo vasudevam

    Will post this on the main page soon. Thanks so much for sharing.


  130. Posted by Pramod Vittal Rao on July 29, 2009 at 8:11 am

    Dear Meera ,

    Please put the below songs in your website as its wonderfull

    1. Narasimha yemba devaru nambidhantha nararigella varava koduvaru…………..
    2. ||hyange madallaya krishna hogutide aiyushya||
    mangalanga bhava bhanga bidisi ninna dingarigana mado ananga janaka||

    The first one audio is posted on youtube, I will post the lyrics as well. I will check and see is I have the lyrics for the second one. Thanks.


  131. Posted by Pramod Vittal Rao on July 30, 2009 at 12:30 pm

    Song: taaraka bindige ………………
    Composer: Purandara Daasa
    Language: KannaDa


    tArakka bindige nA nIrighOguve tArE bindigeye bindige oDedare ondE kAsu tArE bindigeye

    caraNam 1

    rAma nAmavembo rasavuLLa nIrige tArE bindigeye kAminiyara kUDe EkAntavADEnu tArE bindigeye

    caraNam 2

    gOvinda embo guNavuLLa nIrige tArE bindigeye AvAva pariyali amrtada pAnake tArE bindigeye

    caraNam 3

    bindu mAdhavana ghaTTakke hOguve tArE bindigeye purandara viTTalage abhiSEka mADuve tArE bindigeye
    Please convert this song in kannada and put it in web site……….

    Regards Pramodha

    Thanks for the song. I will post it soon.


  132. Hello,

    I would be very grateful to u if u can forward Script in Kannada of Sri Raghavendraswamy i.e. JayaJaya Veeve Raghavendra Bhava Bhaya Haraka Raghavendra as I want to take out copies and distribute to bhaktas to have a group recital on Madhya Aradhana Day which is being celeberated by me due to Gurugala Krupa on 8th Aug 2009

    I will be much obliged for ur help in this regard

    With regards and with a Prayer in Rayaru to bless u always with whatever u desire

    <emNagaraja Avare, I don't have the soft copy in Kannada for this song. I tried scanning, it is an old book with many pages torn.


  133. Posted by Shubha on August 7, 2009 at 3:12 pm

    Hello Meera,

    Do you need the lyrics of the Kannada script for Sri Srinivasa kalyana composed by Sri vadiraja theertharu.. I have it in kannada I can scan and send it across. The song is “Streeyarella bannire Srinivasa paadire”.

    Just let me know..

    Hi Shubha, yes please send it to me. I will post the same.


  134. Posted by seema on August 16, 2009 at 7:12 pm

    Hi Meera,

    Do you have the lyrics for “Rama Rama mukunda maadhava Raama sadguru keshava” ,one of my friend use to sing it in school and i use to love it…..i will be delighted if i get the lyrics for this one. 🙂

    I don’t think I have heard this sing, Seema.


  135. Posted by rachana on August 17, 2009 at 1:35 am

    hi meera ji,
    i was very happy to view dis page. do u hav d lyrics for hanumantha hanumantha sung by raichur sheshagiridas?
    i like dat song but i couldnt get it .so could u plz check it??



  136. hi meera ji,
    i was happy to view this page. Iwant the lyrics for the song”hanumantha hanumantha” by urgaadri daasaru.plzzzzzzzz could u check it and mail it to me??


    I don’t think I have heard that song, Rachana.


  137. Posted by veeru on August 20, 2009 at 1:10 pm

    Hi Meeraji,
    Can i get the Vinayaka chavathi vratha vidhana in kannada lyrics


  138. Posted by meeraghu on August 20, 2009 at 1:12 pm

    Sorry Veeruji,
    I tried scanning the pages with two cameras, nothing is legible. I don’t have access to an actual scanner, so I can’t post it. I will try next year hopefully.


  139. Posted by pramod on August 24, 2009 at 9:56 am

    Hello Meeraji ,

    if you found pancharathna keerthana written by thagarajaru please post it .
    i am not find it any where in websites.



  140. Hello Meera,

    Could you please mail me the kannada lyrics of Hanuman Chalisa. I tried downloading from this link –
    but there seems to be some problem, the page itself does not get opened .

    So, please e- mail me the kannada lyrics of Hanuman Chalisa.
    Thank u

    Hema, try this link


  141. Posted by Guruprasad on August 28, 2009 at 6:39 am


    I am looking for lyrics in kannada for arathi song “Jai ambe gouri…” Can any one have it please mail it to me. My e mail is,

    Who has composed this song, May I know?


  142. Posted by shruthi on September 7, 2009 at 5:18 am

    hello all,
    nenevenanudhina is the song tats been written by vadirajaru….it tells the story of bhagavata’s 10th skanda about Lord kridhna if any of u know the lyrics please update it…



  143. please could you get me the lyrics of ‘Yelu nee Ganaraja” sung by Shri SP Balsubranium. It’s better is I get all the songs of “Gajanana Geearadhana” sung by Shri S P Balsubramanium.


  144. Posted by vallivasanth on September 20, 2009 at 4:22 am

    this site has loads of info about sri anjaneya swami both in english n tamil


  145. Posted by shuba on September 24, 2009 at 2:45 am

    Hi Meera , hello everyone here ,

    Thank you for posting the Srinivas Kalyana song.

    I´m looking for the lyrics of a jo jo song I heard as a child.

    It goes something like this … `aascharya janaka vagi, nirmisida paccheya tottilalli …. etc etc etc.. tugidaru matsyavatara hariya `… etc … I think for all the dashavatara devarugalu. ‘

    I´m sorry about the vague details but it´s all I remember.
    It would be great if someone recognises it!

    Thank you.


  146. Posted by shuba on September 24, 2009 at 3:20 am

    Hello again!

    One more request ….
    ‘ mangalaani santatham bhavanthute …. etc…mmmm… etc… ranganayaki pranesha keshava ‘ … does anyone have the lyrics for this song?

    Thank you


  147. Posted by kk on October 3, 2009 at 7:08 am

    Lambodara lakumikara
    ambaa suta amara vinuta
    lambodara lakumikara



  148. Posted by Pramod Vittal Rao on October 5, 2009 at 8:21 am

    Hello Meera ,

    how was mantralayam trip. as on today it had been havoced by floods.
    When i heard the news that mantralayam was affected by floods ,
    the first think i got in my mind was you which you had planned to go there.
    hope you returned saftely.

    Awaiting your response at the earliest.



    • Posted by meeraghu on October 9, 2009 at 10:02 am

      Pramodha Avare,
      Yes, I did return safely just one day before it flooded. It was indeed a miracle. I will post soon about my visit and all the pictures and video I took while in Mantralaya.


  149. Posted by Pramod Vittal Rao on October 7, 2009 at 12:25 pm

    Hello ,

    Can anyone provide the lyrics of

    1. Shri Shiva Stuthi – composed by Sri Narayanapandithacharya
    2. Shri Vishnu Sthuti – composed by Sri Trivakramapandithacharya

    please provide if anyone found it.
    Plese forward the same to my email ( )

    warm regards


  150. @kk:
    The video song of lambodara from navakoti narayana film in balamurali krishna voice is available free at:

    Also available to listen and read lyrics at::

    Please try the above links


    Meera: Thanks for sharing the links.


  151. Posted by ARUN on October 13, 2009 at 3:49 am

    Great work.Please keep up the fantastic work.


  152. Mitrare,

    Can someone help me by sending Kannada lyrics for Nama ramayana ( of MS fame)…
    which goes shudhdha brahma paratpara ram |


    Meera: I will check, I am sure I have the lyrics.


  153. Dear Meera-avare:

    You are doing a yeoman’s job of love and shradha for God. My best wishes to you. I am looking for Kannada lipi “Kanakadhara Stotram” by Adi Sankara bhagavatpada. Can you direct me to a website or other venue? I am a kannadiga from Bengaluru

    I live in Oklahoma City. I have been fortunate enough to be involved in the Temple and India Cultural Foundation built here. I developed many bhajan books for the temple in english trasliteration.

    I am so proud and happy to see your efforts. Happy Deepavali.

    Thank you,
    Devaki Ganesan


  154. Namaskaram.,

    I am looking for Hari Vayu Stuthi in Tamil or English for daily prayer.
    Please arrange to send it to my email :
    Thanks and regards,


  155. Posted by soyhweta shen on November 2, 2009 at 3:28 am

    please ..can u gv me the lyrics of seridhe ninna venkata ranna…………………………………………………..


  156. Posted by Sindhu on November 3, 2009 at 6:42 am

    Hi Meera,
    This is a great website and especially I appreciate it because the lyrics are also in Kannada. Could you please post the lyrics for “Nammamma Shaarade Uma Maheshwari…” by Sri Kanakadassaru? This is a popular kriti and I might have missed it on your webpage.
    Thank you,


  157. Posted by Venkatesh on November 7, 2009 at 5:19 pm

    Thanks for all the songs. Can you please add “Shiva Mahamrityunjaya Mantra” to your list with lyrics.


    • Hello Venkatesh,

      Here it is,.,.any google search can yield this…

      Om Trayambakam Yajamahe
      Sugandhim Pushti Vardhanam
      Urvarukamiva Bandhanat
      Mrutyor Mukshiya Mamrutat

      kannadadalli bEkaa…nimage aagadiddare baredu kodteeni…

      Listen and see on youtube:


      Nagesh in Chennai

      Meera ,

      can we use kannada fonts here in baraha you have any problems…?



  158. Arunam lyrics in Kannada please, anyone?

    It sems to be part of the Veda book…It is supposed to be very good for reciting for Surya dosham in horoscope of gochara phala…


    Nagesh in chennai


  159. Posted by Thulasi GuruPrasad on November 16, 2009 at 2:11 am

    Dear Mrs Meera,

    Its a joy to visit your website, which I do most often. I have a request…Can you arrange to include the transliteration in English of ‘Harikathamruthasara’ in your website…I know its a voluminous work…but its worth making it available..And I will be very grateful to you….

    K. Thulasi


  160. Posted by Dear Mrs Meera on November 17, 2009 at 4:13 am

    You are doing a fantastic job & service by collecting all the devotional songs/ slokas.
    I found this website quite interesting. I got lyrics of gajamukhane , which was required to teach my daughter.
    Will be visiting this site frequently.

    Thanks & regards


  161. Posted by sushma on November 17, 2009 at 4:20 am


    It would be greatful if u could send me lyrics of this song

    “Nee namma belakagi ba gajamukhane” , I remember this song from my school days & like it very much



  162. Posted by Muralidhara on November 19, 2009 at 2:48 pm

    Hi Meera,

    Can you send me all kannada devotional songs, slokas, Stotram & lyrics in BARAHA kannada

    It will be of great peace of mind if you include specially vinayaka, shiva, anjaneya, shri krishna & shani mathama. I do have few books but in those book pronunciation is difficult to learn. So it will be kind enough to help me out to learn.

    Best Wishes for your all your efforts that causing change in lives

    With Best of Regards



  163. Posted by Sandhya on November 19, 2009 at 11:34 pm

    Hare Srinivasa…….

    Hi Meera,

    Its really a great work done by you. Carry forward….



  164. Posted by meeraghu on November 20, 2009 at 8:49 am

    Thanks so much, Sandhya. Appreciate your comments.


  165. Posted by J. V. Adavi on November 29, 2009 at 3:17 pm

    Dear Meera,

    I have already posted a request, but do not know whether it has reached you or not. I had asked for the lyric and tune of “aarati belagire maramanage vara………..”. You have already sung the song “aarati belagire naariyarellaru……….”, and the tune is the same. Can you just send the full text of “aarati belagire maramanage vara………” either in kannada or in English script?


    J. V. Adavi


  166. Posted by Ramya on December 11, 2009 at 6:16 pm

    Hi Meera,

    very good website..Can u plz send me lyrics of “udhyadhbanu sahasra koti sadrusham,keyura harojwalam” sloka… either in english or kannada ..



    • Posted by meeraghu on December 15, 2009 at 9:03 am

      I haven’t heard that song. Who is the composer?


    • Posted by Bhargavi on August 5, 2010 at 2:29 am

      Hi.. It is not a song It is a set of shloka called Sri Shankaracharya virachita Meenakshi Pancharatnam. I have the kannada version of it. Will surely give it to U. I can forward it to Meera Madam.
      Thank you,


  167. Posted by Bindu priya on December 16, 2009 at 8:18 am

    Hi meera avare,

    can u pl send me “ANU HARIKATHAMRUTHASARA” in telugu ..

    Bindu Priya


  168. Posted by radha on December 23, 2009 at 4:41 am

    hello meera,
    very good website. can u send me the lyrics of venkatesa subrabatham in tamil


  169. Posted by meeraghu on December 23, 2009 at 8:28 am

    Sorry, Radha. I don’t know Tamil.


  170. Posted by Narayana Gadikai on December 30, 2009 at 12:19 pm

    When you transliterate from Devanagari to Kannada, “e” & “o” should always be “Dheerga” but not “Hrasva”. eg.
    Mahaamaye~, Sripeethe~, Poojite~, etc.


  171. Posted by Valli Sudarshan on January 1, 2010 at 9:24 pm


    If you have the lyrics for Nama Ramayana in Kannada, I would appreciate receiving it.

    Best regards,

    Valli Sudarshan


  172. Posted by Gayatri on January 10, 2010 at 9:21 pm

    Hi Meera,

    Great site. This has become my go-to place for easy and quick receipes esp. on the days when I come home late after work and driving my daughter around for her activities.

    I am looking for the lyrics for the following songs. I believe they are by Purandaradasaru. My mom used to sing these on Krishnashtami. If you are not aware of these songs, I hope one of your readers would be able help. I am not fluent in reading Kannada, so either English or Hindi will be helpful. Thanks.

    1. Poppu hogonna baa baro ranga poppu hogona baa….
    2. Yava koolavo ranga yava koolavo….


    • Posted by meeraghu on January 11, 2010 at 9:03 am

      Thanks so much for your wonderful comments. Appreciate very much.
      I do have the lyrics for both the songs you have requested. However, it is in Kannada.


      • Posted by Gayatri on January 11, 2010 at 3:34 pm

        Thats great Meera. You can send it in Kannada, I will get someone to help me translate it. Thanks.

  173. Posted by sunny on January 11, 2010 at 12:16 am

    Folks, do not follow the link Baraha. It is infected. whomsover is directing people to that link is either ignorent about the computer virus or is doing it deliberately.. anyway watch out..


    • Posted by meeraghu on January 11, 2010 at 9:04 am

      I have removed the link to Baraha. it was when I looked to edit the post. Not sure what you meant either. If anyone wants to download Baraha, they can always google. Thanks so much.


  174. Posted by Vindhya on January 16, 2010 at 2:00 pm


    Could you please provide the script for “Udupiya Kandira Udupiya Krishnana Kandera”. I don’t know if this is the beginning of the song.. This is also sung by Sri Vidyabhushan.

    Thank you
    Best Regards


  175. Posted by raghavendra on January 19, 2010 at 1:33 am


    anybody got the lyrics of yaake mokanaade guruve nee..

    thanks ,


  176. Posted by V.Rajasekaran on January 23, 2010 at 3:59 am


    that is a good site,. If possible could you please let me know where I can find the Chief Acharya of Mantralayam Mutt’s Programme . I want to see him when I visit Mantralayam in February; First time when I went He was not there.

    And also the Coconut Seva for any particulat boon – how to perform it?

    Thanks in Advance


  177. Posted by meeraghu on January 23, 2010 at 10:14 am

    You should be able to get the details from Mantralaya web site. I am not sure I understand your question about the coconut seva.


  178. Hello,

    I am trying to find Asta Lakshmi Stotra lyrics starts like this Mangala roopini mangala dayini sarva mangale baaramma. Venkataramana binkada raminiye sankata harisu nammamma. Mantra nivasini mantra swaroopini Aadilakshmi mai doramma……….

    I am not sure this Stotra has been taken in some old Kannada film as well. I think Shreenath acted. There it starts from Padmini Padmalaye Padmakshi Padmamukhi Padmanabha priye…………


  179. Posted by meeraghu on January 27, 2010 at 8:05 am

    I don’t think I have the lyrics. Sorry about that.


  180. Posted by Ashwini on February 7, 2010 at 9:28 pm


    I was looking for Shyamala Dandakam in Kannada. Can you please help me.


  181. Posted by Gayatri on February 17, 2010 at 11:12 pm

    Hi Meera,

    Do you have the lyrics for ‘Neenu Yako. Ninna Hungu Yako. Ninna Naamadha bala ondhe idharey saku.’ This is by Sri Purandaradasaru.


  182. Posted by rukmanihariprasath on February 28, 2010 at 9:34 pm

    meerasubbarao avargallige namaskaragalu
    nandu ondu vidyapane, nanage HARI BHAKTI SARA LYRICS bekku. can u pls upload me if possible.
    nimma dayadinda navu raghavendra saptaha vanna nodi ananda padethavu.


  183. Posted by meeraghu on March 2, 2010 at 8:03 pm

    I don’t have those right now. Thanks so much for your wonderful comments.


  184. Dear Madam,

    I want the lyrics in tamil and MP3 of songs written by Raghvendra Swamy. Can you please tell me the website ?


  185. Posted by yadava on April 26, 2010 at 11:32 am

    Hello Madam,
    This is the first time am visiting your blog site, am pleased to know about your knowledge bank!!. This day is gr8 for me. Am really spell bound for this site.
    I with gr8 hindrance am suggesting you to please correct the kannada spelling, which are in shlokas’,
    I learn that, if any shloka is recited without proper swara, it will have adverse affect on the reciter. Please consider this keen comment.


  186. Posted by Nina on April 26, 2010 at 7:00 pm

    Could you please post Purandaradaasa rachita “Narayana Ninna Naamada smaraneya…?” It is a delight to see lyrics to many songs in Kannada. Keep up the good work. DhanyavaadagaLu.


  187. Posted by meeraghu on April 26, 2010 at 8:25 pm

    Sure, Nina. I will post the same.
    However, the lyrics are in Kannada at at the following link:


  188. Posted by Bharath on April 27, 2010 at 11:16 am

    May i get the lyrics and audio file (if possible) for Narasimha akshramala stotram please.


  189. Posted by Nina on April 27, 2010 at 10:31 pm

    Dear meera,
    Thanks for the quick response!
    Do you know a Samskirta stothra on Gauri/Parvathi that goes like this “Gaurim Amba Amburuhaakshim AhamiDe..” I have some vague recollection of a few lines, but cannot recall the beginning of the stothra. My maternal aunt used to recite this 🙂


  190. Posted by meeraghu on April 29, 2010 at 5:36 pm

    I don’t think I have heard the same. Sorry about that.


  191. Posted by venkatesh on May 3, 2010 at 6:44 am

    Dear All,

    I need english version of Ragvendra Stotra. Can any one send me plz. Here is mi id


  192. Posted by Shilpa on May 4, 2010 at 1:50 pm

    Hi Meera,

    I was wondering if you know of any Kannada songs for the “Seemantha” ceremony.

    Thank you,


  193. Posted by sayi on May 13, 2010 at 6:35 am

    dear madam
    I posted u slokas relating to “RAGHAVENDRA”.dID U RECEIVE IT.Thanks and regards


  194. Dear Madam,
    IN my humble way I also try to popularize these stotras in english. I also have several other hobbies and live in Bangalore.Please visit
    Kindly visit my web pages :-
    1. For reading translations of 469 stotras:
    2. For reading about 58 Kerala temples:
    3. For reading about rules and rituals of Brahmins:
    4. For reading Raja Thatha’s 77 Blogs :
    5. For reading about, 54 village gods of Tamil Nadu :
    6. For reading about meanings of 239 Carnatic music krithis :
    7. For reading stories and rhymes for children:
    8. For reading poems by Ramachander :;;item=all
    9. For stories illustrating Malayalam Proverbs :


  195. Posted by srikant raghavendra on May 26, 2010 at 2:26 am

    hi … madam please could you send me the audio of Palayachyutha palayajitha – by Shri Vadiraja Thirtharu on Lord Krishna of Udupi.
    i searched for it but was not able to find it .
    thanks very much .


  196. Posted by vinutha on June 17, 2010 at 6:02 am

    hai this is vinutha.. actually i want a lyrics for vaara banthamma song.. it would be really helpul if you post me that song lyrics….


  197. Posted by meeraghu on June 17, 2010 at 7:55 pm

    I will try and post the lyrics as and when time permits.


  198. Posted by Vijay Kumar K on June 27, 2010 at 1:11 am


    I require Tamil Lyrics of Shiva Slokas like Arunachalane, Hara Hara Sivane, Om Namasivaya and Siva Mayamana (all sung by SPB). As I am not that internet savvy, I am not able to download the same. Can you help me out as my mother would like to have the lyrics. You can please get in touch with me at Thanks in anticipation…


  199. Posted by meeraghu on June 29, 2010 at 7:44 am

    I am not sure I have the lyrics for the slokas you are asking. I will share if someone can send me the lyrics.


  200. Posted by proshitha on July 7, 2010 at 12:53 am

    m looking for lyrics of sarawati vishwa vijay kavach in either in kannada or would be helpful to me..thanks


  201. Posted by Chandana Mahesh on July 7, 2010 at 3:09 am

    Hello Meera,

    I found your website while I was searching for lyrics of “Pavamana Jagadha prana”. I found it on your website.

    When I went through the website I was really very happy seeing to your interest in our culture.

    I would like to request you to send me the lyrics of “Entha prabhuva kaneno” dasara pada. in English and Hindi. I would be a great help for me if you can share it with me.

    Thanks & regards,


  202. Posted by Kusuma Arvind on July 23, 2010 at 6:45 am

    Hi Meera,

    Thank you very much for all the lyrics. I was so happy going through them. thanks once again. Great job keep going.


  203. Posted by Murali on July 24, 2010 at 3:44 pm

    ಮೀರಾ ಅವರುಗೆ:

    ಬಹಳ ಧನ್ಯವಾದಗಳು. ಇಲ್ಲಿ ಇರುವ ಕನ್ನಡ ಸ್ತೋತ್ರಗಳು ಅಧೆಷ್ಟು ಚನ್ನಾಗಿದೆಂದರೆ ಹೇಳುವುದಕ್ಕೇ ಆಗುವುದಿಲ್ಲ.

    ಅದೆಷ್ಟು ದಿನಗಳಿಂದ ಇದನ್ನು ಹುಡುಕುತ್ತಿದ್ದೆ.

    ದಯವಿಟ್ಟು ಈ ಕೆಲಸವನ್ನೂ ನಿಲ್ಲಿಸಬೇಡಿ. ಇನ್ನೂ ಬಹಳ ಸ್ತೋತ್ರ, ವೇದ, ಹಾಡುಗಳು ಎಲ್ಲವೂ ಸೇರಿಸಿ ಈ ಸೈಟ್ ಪ್ರಪಂಚ ಕನ್ನಡಿಗರಿಗೆ ಮಾರ್ಗದರ್ಶನ ಕೊಡಲಿ ಅಂತ ನಮ್ಮ ಬಯಕೆ.

    ದೆಅವರು ನಿಮಗೆ ಆ ಶಕ್ತಿಯನ್ನೂ ನೀಡಲಿ,

    ಪ್ಲೇನೋ, ಟೆಕ್ಸಾಸ್, ಅಮೆರಿಕ.


  204. Posted by Lingraj Gavimath on July 30, 2010 at 8:04 am

    Namaskara akka,

    Nann Hesaru Lingraj anta. Ee site nodi tumba tumba aanada aiytu . Nanage erdu haadu bekiddavu. NAnage sigta illa. Naanu UK nallideeni adakke kashta aagta ide.

    1. Amba bhavani, Jagadamba bhavani.

    2. Anabaaradenande naa , amba ninaga.

    These are like North Karnataka Songs .

    Thankyou VEry much .

    My email address is


  205. Dear Meera: I accidentally came across your site and you are doing a wonderful job.
    I want to let you know that I have the lyrics for over 14000 Karnatak songs by various composers. The lyrics are in english and in ITRANS format. I would be happy to cater to any requests for songs. Thanks.


  206. Posted by PINKY on August 3, 2010 at 1:47 am

    HARI OM,

    could you check VIJAYAPRADA STOTRAM in yr list. pls give the lyrics and how to use it


  207. Posted by PINKY on August 3, 2010 at 1:51 am

    hari om,
    actually its a prarambha stotram i think . starting with something like kailasamaya saile vanurulum nandinidevi kanthe


  208. Please specify the lyrics. Thanks.


  209. Posted by Bhargavi on August 5, 2010 at 1:05 am

    Hello Meera madam,
    I would like to request you to post YantrodhAraka Hanumanta stotra in Kannada. Please I am in need of it. If you do have it, please post it online.
    Thank you,


    • Posted by meeraghu on August 5, 2010 at 4:36 pm

      Below is the lyrics in English. I will post the kannada version pdf in a day or two.


    • Namami dhootham, ramasya sukhadam, suradrumam,
      Peena vrutha maha bahum, sarva Shatru nivaranam.
      Nanarathna samayuktha kundaladhi virajitham,
      Sarvada abheeshta datharam, satham vai drudamahave.
      Vaasinam chakra theerthasya, dakshniastha girou sada,
      Thungaboditha rangasya, vathena parishobithe.
      Nana desa gathai sadhbhi, sevyamanam nrupothamai,
      Dhoopa dheepadhi naivedhyai, pancha khadyaischa shakthitha.
      Bhajami hanumantham hema kanthi Sama prabham,
      Vyasa theertha yatheendrena poojitham cha vidhanatha.
      Trivaram ya paden nithyam, bhkthya dwijothama,
      Vanchitham labhathe abeeshtam, shanmasabhyanthare kalu.
      Puthrarthi labhathe puthram, yasorthi labhathe yasa,
      Vidhyarthi labhathe vidhyam, dhanarthi labhathe dhanam.
      Sarvadha maasthu sandeho, Hari sakshi jagatpati,
      Ya karoth yathra sandeham, sa yathi narakam dhruvam.


    • Posted by amma on September 23, 2011 at 8:24 am

      Here is the Kannada version

      ನಮಾಮಿ ಧೂತಂ, ರಾಮಸ್ಯ ಸುಖದಂ, ಸುಂದರಂ,
      ಪೀಣವೃತ ಮಹಾಬಾಹು, ಸರ್ವ ಶತ್ರು ನಿವಾರಣಂ.

      ನಾನಾರತ್ನ ಸಂಯುಕ್ತ ಕುಂಡಲಾದಿ ವಿರಾಜಿತಂ,
      ಸರ್ವ ಅಭೀಷ್ಟ ಧಾತಾರಂ, ಶತಂ ವೈ ದ್ರುಢಾಮಾಹವೆ.
      ವಾಸಿನಾಂ ಚಕ್ರ ತೀಥ೯ಸ್ಯ, ದಕ್ಷಣೈಸ್ತ ಗಿರೋ೯ಸದಾ,
      ತುಂಗಭೋದಿತ ರಂಗಸ್ಯ, ವಾತೀನ ಪರಿಶೋಭಿತೆ.
      ನಾನಾ ದೇಶ ಗತೈ ಸದ್ಭಿಃ, ಸೇವ್ಯಮಾನ ನೃಪೋತ್ತಮೈ,
      ಧೂಪದೀಪಾದಿ ನೈವೀದೈಃ ಪಂಚ ಖಾದೈಶ್ಚ ಶಕ್ತಿಥ.
      ಭಜಾಮಿ ಹನೂಮನ್ ತಂ ಹೇಮಕಾಂತಿ ಸಮಪ್ರಭಂ,
      ವ್ಯಾಸತೀ೯ಥ ಯತೇಂದ್ರೇನ ಪೂಜಿತಂ ಚ ವಿಧಾನತ.
      ತ್ರಿವಾರಂ ಯ ಪಠೇನ್ನಿತ್ಯಂ ಭಕ್ಯಾ ದ್ವಿಜೋತ್ತಮ,
      ವಾಂಚಿತಂ ಲಭತೀ ಅಭೀಷ್ಟಂ ಷಣ್ ಮಾಸಭ್ಯಾಂತರೇ ಖಲು
      ಪುತ್ರತೈ ಲಭತೇ ಪುತ್ರಂ ಯಶೋರ್ಥಿ ಲಭತೇ ಯಷ
      ವಿಧ್ಯಾ೯ಥಿ ಲಭತೇ ವಿಧ್ಯಾ ಧನಾ೯ಥಿ ಲಭತೇ ಧನಂ
      ಸರ್೯ವದಾ ನಾಸ್ತುಸಂದೇಹೋ ಹರಿ ಶಕ್ತಿ ಜಗತ್ ಪತಿಃ

      I use Safari to show kannada in the browser, for windows I am sure IE will display as well

      I have the PDF how do you upload that


  210. namAmi dUtam, ramasya sukhadam, suradrumam,
    pIna vrutha maha bahum, sarva Shatru nivaraNam.
    nAnAratna samayukta kuNDaladhi virAjitam,
    sarvadA abhIShTa dAtAram, shatam vai druDhamAhavE.
    vAsinam chakra tIrrthasya, dakShniastha girou sadA,
    tungabOdhita rangasya, vAtEna parishobithE.
    nAnA dEsha gathai sadbhi, sEvyamAnam nrupOtamai,
    dhUpa dIpAdi naivEyai, panca khaDaischa shaktita.
    bajAmi hanumantam hEma kAnti sama prabham,
    vyAsa tIrrtha yatIndrENa pUjitam ca vidanAtha.
    trivaram ya paden nityam, bhktya dvijotama,
    vAncitam labhatE abhIShTam, shanmasabhyantarE khalu.
    putrArti labhatE putram, yasOrti labhatE yasa,
    vidhyArthi labhatE vidyam, dhanarti labhatE dhanam.
    sarvadA mAstu sandEhO, hari sAkShi jagatpati,
    yA karOt yatra sandEham, sa yati narakam dhruvam.


  211. Posted by Bhargavi on August 7, 2010 at 12:01 am

    Dear Meera madam,
    One of you visitors had requested for this particular shloka. Please add this to your list. It is a very small service done to u from my side. Thank You

    Shri Shankaracharya virachita MEENAKSHI PANCHARATNAM
    ಉದ್ಯದ್ಭಾನು ಸಹಸ್ರ ಕೋಟಿ ಸದ್ರುಶಾಂ ಕೇಯೂರ ಹಾರೋಜ್ವಲಾಂ
    ಬಿಂಬೋಷ್ಠೀಂ ಸ್ಮಿತ ದಂತ ಪಂಕ್ತಿ ರುಚಿರಾಂ ಪೀತಾಂಬರಾಲಂಕೃತಾಂ
    ವಿಷ್ಣು ಬ್ರಹ್ಮ ಸುರೇಂದ್ರ ಸೇವಿತ ಪದಾಂ ತತ್ವಸ್ವರೂಪಾಂ ಶಿವಾಂ
    ಮೀನಾಕ್ಷೀಂ ಪ್ರಣತೋಸ್ಮಿ ಸಂತತಮಹಂ ಕಾರುಣ್ಯ ವಾರಾಂ ನಿಧಿಂ -೧-

    ಮುಕ್ತಾ ಹಾರಲಸತ್ ಕಿರೀಟ ರುಚಿರಾಂ ಪೂರ್ಣೇಂದು ವಕ್ತ್ರೇ ಪ್ರಭಾಂ
    ಶಿಂಜನ್ನೂಪುರ ಕಿಂಕಿಣೀ ಮಣಿ ಧಾರಾಂ ಪದ್ಮ ಪ್ರಭಾಂ ಸುರಾಂ
    ಸರ್ವಾಭೀಷ್ಠ ಫಲ ಪ್ರದಾಂ ಗಿರಿ ಸುತಾಂ ವಾಣೀರ ಮಾ ಸೇವಿತಾಂ
    ಮೀನಾಕ್ಷೀಂ ಪ್ರಣತೋಸ್ಮಿ ಸಂತತಮಹಂ ಕಾರುಣ್ಯ ವಾರಾಂ ನಿಧಿಂ -೨-

    ಶ್ರೀ ವಿದ್ಯಾಂ ಶಿವ ವಾಮ ಭಾಗ ನಿಲಯಾಂ ಹ್ರೀಂಕಾರ ಮಂತ್ರೋಜ್ವಲಾಂ
    ಶ್ರೀ ಚಕ್ರಾಂಕಿತ ಬಿಂದು ಮಧ್ಯ ವಸತೀಂ ಶ್ರೀಮತ್ ಪ್ರಭಾ ನಾಯಕೀಂ
    ಶ್ರೀಮತ್ ಷಣ್ಮುಖ ವಿಘ್ನರಾಜ ಜನನೀಮ್ ಶ್ರೀಮತ್ ಜಗನ್ಮೋಹಿನೀಂ
    ಮೀನಾಕ್ಷೀಂ ಪ್ರಣತೋಸ್ಮಿ ಸಂತತಮಹಂ ಕಾರುಣ್ಯ ವಾರಾಂ ನಿಧಿಂ -೩-

    ಶ್ರೀಮತ್ ಸುಂದರ ನಾಯಕೀಂ ಭಯ ಹರಾಂ ಙಾನ ಪ್ರದಾಂ ನಿರ್ಮಲಾಂ
    ಶ್ಯಾಮಭಾಂ ಕಮಲಾಸನಾರ್ಚಿತ ಪದಾಂ ನಾರಾಯಣಸ್ಯಾನುಜಾಂ
    ವೀಣಾ ವೇಣು ಮೃದಂಗ ವಾದ್ಯ ರಸಿಕಾಂ ನಾನಾವಿಧಾಡಂಭಿಕಾಂ
    ಮೀನಾಕ್ಷೀಂ ಪ್ರಣತೋಸ್ಮಿ ಸಂತತಮಹಂ ಕಾರುಣ್ಯ ವಾರಾಂ ನಿಧಿಂ -೪-

    ನಾನಾ ಯೋಗಿ ಮುನೀಂದ್ರ ಹೃನ್ನಿ ವಸತೀಂ ನಾನಾರ್ಥ ಸಿದ್ಧಿ ಪ್ರದಾಂ
    ನಾನಾ ಪುಷ್ಪ ವಿರಾಜಿತಾಂಘ್ರಿ ಯುಗಲಾಂ ನಾರಾಯಣೇನಾರ್ಚಿತಾಂ
    ನಾದ ಬ್ರಹ್ಮ ಮಯೀಂ ಪರಾತ್ಪರತರಾಂ ನಾನಾರ್ಥ ತತ್ವಾತ್ಮಿಕಾಂ
    ಮೀನಾಕ್ಷೀಂ ಪ್ರಣತೋಸ್ಮಿ ಸಂತತಮಹಂ ಕಾರುಣ್ಯ ವಾರಾಂ ನಿಧಿಂ -೫-

    And here is the english version of it.
    udyadbhaanu sahasra kOTi sadruSaaM kEyUra haarOjvalaaM
    biMbOShThIM smita daMta paMkti ruchiraaM peetaaMbaraalaMkRutaaM
    viShNu brahma surEMdra sEvita padaaM tatvasvaroopaaM shivaaM
    meenaakShIM praNatOsmi saMtatamahaM kaaruNya vaaraaM nidhiM -1-

    muktaa haaralasat kireeTa ruchiraaM poorNEMdu vaktrE praBaaM
    shiMjannUpura kiMkiNI maNi dhaaraaM padma prabhaaM suraaM
    sarvaabhIShTha phala pradaaM giri sutaaM vaaNeera maa sEvitAM
    meenaakShIM praNatOsmi saMtatamahaM kaaruNya vaaraaM nidhiM -2-

    shrI vidyaaM shiva vaama Baaga nilayaaM hrIMkaara maMtrOjvalaaM
    shrI cakraaMkita biMdu madhya vasatIM shrImat prabhaa naayakIM
    shrImat ShaNmuKa vighnaraaja jananIm shrImat jaganmOhinIM
    meenaakShIM praNatOsmi saMtatamahaM kaaruNya vaaraaM nidhiM -3-

    shreemat suMdara naayakeeM bhaya haraaM ~gaana pradaaM nirmalaaM
    shyaamabhaaM kamalaasanaarchita padaaM naaraayaNasyaanujaaM
    veeNaa vENu mRudaMga vaadya rasikaaM naanaavidhaaDaMbhikaaM
    meenaakShIM praNatOsmi saMtatamahaM kaaruNya vaaraaM nidhiM -4-

    naanaa yOgi muneeMdra hRunni vasatIM naanaartha siddhi pradaaM
    naanaa puShpa viraajitaaMghri yugalaaM naaraayaNEnaarchitaaM
    naada brahma mayIM paraatparataraaM naanaartha tatvaatmikaaM
    meenaakShIM praNatOsmi saMtatamahaM kaaruNya vaaraaM nidhiM -5-


  212. Posted by meeraghu on August 7, 2010 at 8:27 am

    Thanks so much, Bhargavi. The post will go live tomorrow.


  213. Posted by Bhargavi on August 9, 2010 at 1:09 am

    Dear Meera Madam,
    Thank You very much for all your concern. This was a small service to the great work what you have been doing it till now. This is a great work what you have been doing and please go on untill the end so. You have been helping people like me with great care and concern. keep up the best work. And your cooking section is also fantastic with rare recipies which my grand mother used to prepare.
    Thank you,
    Mrs.Bhargavi Vidyashankar


  214. Posted by Soumya on August 18, 2010 at 2:31 am

    hello meera,

    Blog is very informative. Can i get the lyrics for “naarasimhanembo srihari..naama girisha….”


  215. Posted by meeraghu on August 18, 2010 at 8:36 am

    I don’t think I have heard this song, Soumya. Can you provide more info?


  216. Hey sorry,
    i had heard it couple of times. i think i should be simharoopa nada srihari nama girisha…


    • simharUpanada. rAgA: kEdAragauLa. Adi tALA. Composer: Purandaradasa.

      P: simharUpanada shrI harE hE nAmagirIshanE
      A: ommanadinda nimmanu bhajisalu sammatadindali kAivanenda harE
      C1: taraLanu kareya stambavu biriyE tumba ugravanu tOridanu karaLanu
      bagedu koraLoLagiTTu taraLana salahida shrI narasimhana
      2: bhaktarella kUDi bahu dUra Odi parama shAntavanu bEDidaru karedu
      tan siriyanu doDeyoLu kuLisida parama haruSavanu pondida shrI hari
      3: jaya jaya jayavendu huvvanu tandu hari hari hariyendu surarella surise
      bhaya nivAraNa bhAgya svarUpanE parama puruSa shrI purandara viTTalanE


  217. Hi Lakshman, Tumba Dhanyavadagalu


  218. Posted by Mrudula Rao on August 19, 2010 at 11:59 pm

    Hey soumya, ur traditionalrangoli site is nice.!!!!


  219. Posted by Gayatri on August 20, 2010 at 5:39 am

    Hi Meera,

    Do you have lyrics for any of the following songs?
    1) Pralhada Charitre – “Jaya Vijayara Bhoo Viakunthadali……”
    2) Sudhama Charitre – “Balakaru Keledali Chamrava beesuta……”
    3) Krishna Krishna yendu, omme nenedare manake………………”


  220. Posted by Sushma Iyengar on August 26, 2010 at 3:33 am

    Hi Meera

    Your website is a wonderland for thirsty souls like me. 🙂

    I was wondering if you knew the following songs. My grandmother sings them on fridays for lakshmi puja.

    They are 1) Sri Vani Kalyanagunamani lok janani
    2) Puje malpenu jaaji pushpa dol
    3) Mangalamaha lakshmi devige mangalama
    4) bamaa bumi suthe baama janaka preethe
    5) girindhra kanya kumari devige aarthi..

    Those are a lot of lyrics to ask for. 🙂 If you know these songs, can you post the lyrics in either English/Hindi/Sanskrit?



  221. Posted by Durgapriye on August 27, 2010 at 8:07 am

    From now on I will look for your website when I need to know about Puja ritual, stothra or songs. You are doing fabulous job.

    Thanks a lot.


  222. Posted by kavimini on August 27, 2010 at 9:53 am

    i need one sloga about cow, the slogam starts sri math naryanarum paramarum indirarum aadhikesavanum ……………………………………………………………………………..
    Kalam ezhunthirunthu kaal alambi vaipooci
    sloga goes like this.( pasum maatu sthothiram)
    Can any one send this sloga to my mail id


  223. Posted by Suman on August 30, 2010 at 11:01 pm

    Dear Meera,
    Good to see such a contented blog abt our culture. I know still lots to get filled in this valuable blog. I have a request. Can u post Durga strotam if u have it becoz I tried it searching, but I couldnt find in internet. Currently i dont have copy of it with me.

    Thanks and Happy blogging,


  224. Posted by prasath on September 2, 2010 at 4:15 am

    i will be greatly obledged if someone provide me the lyrics for the following songs either in english or in sanskrit
    raghavendra yathi saarva bourma
    by sri jagannatha dasaru
    thanks from


    • rAghavEndra yati. rAgA: dhanyAsi/bilAval. Adi/kaharvA tALA.

      P: rAghavEndra yati sArvabhauma duritaugha dUra tE namO namO
      mAgadharIpumata sAgara mIna mahAgha vinAshana namO namO
      A: shlAgita guNagaNa sUri prasanga sadAgamajna tE namO namO
      mEgha shyAmala rAmArAdaka mOgha bOdha tE namO namO
      C1: tungabhadra sutarangiNi tIraga mangaLa carita shubhAnga namO
      ingitajna kALinga mardhana yadupungava hrdaya turanga namO
      sangira cihnita shrngArAnana tingaLa karuNApAnga namO
      gAngEya sama bhAnga kumata mAtanga sangha citapinga namO
      2: kOvida mastaka shObhita maNI smbhAvita mahima pAlayamAm
      sEvApara sarvArthaprada brndAvana mandira pAlayamAm
      bhAvaja mArgaNa bhujaga vinAyaka bhAvajna priya pAlaya mAm
      kEvala nutajana pAvana rUpa sadA vinOdi hE pAlaya mAm
      3: shrI sudhIndra karajAta namO namO bhUsura vinuta vikhyAta namO namO
      dEshika vara samsEvya namO namO dOSa vivarjita kAvya namO
      klEshita jana paripala namO namO bhUSita karuNA shIla namO
      vyAsarAya pada bhakta namO namO shAsvata dharmAsakta namO
      4: sannuta mahima shrI jagannAtha viThala sahnita mAnasa jaya jaya bhO
      cihnita daNDa kamaNDala puNDra prapanna bhayApaha jaya jaya bhO
      mAnya mahAtma prasanna vadana kAruNyapayOnidhi jaya jaya bhO
      dhanya kSEma sampannadharAmara sharaNya sadArthita jaya jaya bhO


      • Posted by meeraghu on September 2, 2010 at 12:37 pm

        Thanks so much, Lakshman. I will post it in a separate thread.

      • Posted by guruprasath on September 7, 2010 at 2:21 am

        yes i got the lyrics ‘raghavendra yathi saarva bouma from one mr.lakshman,thanks a lot, i never forget this help
        thanks from

  225. Posted by savita on September 2, 2010 at 11:11 am


    Your blog is too good. Actually I have lost the Sampat shanivarad Haadu and for this I have to go to Hubballi (I stay in Bombay).
    Thanks I will write u later


  226. Posted by Sharath on September 6, 2010 at 1:45 am

    Pls, Pls, Pls, Pls, send me the lyrics of ‘Nee namma Belakagi baa gajamukhane, ne namma belakaaagi baaa, Gurukulake varavagi. . . . . . . . ” to my email id.


  227. can any one send me the lyrics for “Loka Bharithano Ranga ” pleeease…


  228. Posted by Ajit on September 10, 2010 at 12:53 pm


    First of all thanks for a fabulous work you are doing to bring together all the Hindu pooja Vidhana and Songs. I am really grateful for this.

    By any chance, if you have the lyrics of “Baare Bhagyada Nidhiye, Karaveeraniva Sinisiriye”, then please upload the same.

    Thanks again and keep up the good work.


  229. Hi Lakshmi,

    Kindly let me if you know the below song lyrics, which is a very beautiful song of venkateshwara

    Vivida Veda Gochara Venkateshwara
    Madhura Bhakatha Mandira Shamasundara……



  230. minor correction may be needed.

    vividha vEda gOcarA. rAgA: rEvati. Adi tALA.

    P: vividha vEda gOcarA venkaTEshvarA madhura bhakta mandirA shyAmasundarA
    kamalanayana garuDagamana kalmaSa haraNA nAga shayana nArAyaNa divyA (?) bharaNA
    sharaNu sharaNu sharaNu sharaNu tirumalagiri rAyA parama puruSa sariyimpaga ceyu muni mAyA
    C1: shrngamula pongulalO sundarAngA nindirangu bhrngimalA ranga rangA
    angaranga vibhava lakSmi antarangA alamElumanga mara prEma bhrgA (vividha… + chorus)
    2: dAsula nE darisEtE dharmashIlA sAmajamE sakalamanE gAnalOlA
    andarI Adarintu nandabAlA alakAla malaru tiru nIdu lIlA (vividha… + chorus)


  231. Posted by arundhati on September 16, 2010 at 9:06 am

    I remember seeing Jagannadha dasaru composition “roga harana” on your website- i am not able to locate it now? Could you please send me the link?

    Thank you for the wonderful job that you doing.

    Best wishes,


  232. Posted by Rajeev on September 17, 2010 at 9:38 am

    Hi Meera,
    Can u get and post Shri Harivayustuti (preferably in Kannada). Coz some places I found it in English, but again when written in English the pronunciation changes quite a lot.

    Thanks and Regards,


  233. Posted by aparna on September 18, 2010 at 3:32 am

    Hi Meera
    Great website.. I was looking for the lyrics of few songs
    1. kanninolage nodo hariya
    2. Modaka priyana Gajana
    3. Sharanu Sharade vani Sarashijaskana rani
    4. MAnmohana murari baro
    5. Ambegal ikkuta banda govinda.

    This is a long list. But as and when possible if you can post the lyrics it will be helpful.



    • Posted by meeraghu on September 18, 2010 at 9:04 am

      Thanks for visiting. I will try to find these and post them.


    • kaNNinoLage nODo. rAgA: kApi. cApu tALA.

      P: kaNNinoLage nODo hariya
      A: oLa kaNNInoLaginda nODO mujjagadoDeyana
      C1: AdhAra modalAda Aru cakra shOdhisi biDa bEku IsaNa mUru
      sADhisi suSumnA Eru alli bhEdisi nI parabrahmana sEru
      2: eve hAkade mEle nODi bEga pavananindali vAyu bandhana mADi
      savidu nAdava pAna mADi alli nava vidha bhaktili nalinalidADi
      3: aNDajadoLADutAne bhAnu maNDala nArAyaNanembOvane
      kuNDali tudiyoLiddAne shrI purandara viTTala pAlisutAne

      ambegallikkuta banda. rAgA: dhanyAsi. aTa tALA.

      P: ambegallikkuta banda gOvinda
      A: ambujanAbha dayadinda enna manege
      C1: jalacara jalavAsa dharaNidhara mrgarUpa nelanLidi mUraDi mADi banda
      kula nAsha vanavAsa navanIta cOraniva lalaneyara vrata bhanga vAhana turanga
      2: kaNNa biDuvanu tanna benna taggisuvanu maNNu kedari kOre bAya teredu
      ciNNa bArgava lakSmaNaNNa benneya kaLL mAnava biTTu kudureyanErida
      3: nIra pokkanu giriya negahi dharaNiya tandu nara mrga bali bandha koraLugoyika
      shura muridoraLeLidu niravANi haya hatti purandara viTTala manege tA banda


      • Posted by meeraghu on September 19, 2010 at 6:56 pm

        Mr. Lakshman,
        Please let me know how you are translating these lyrics. I tried copying your lyrics into Baraha and translate into Kannada, it didn’t turn out correctly. This would help me to post all these songs in their own posts so it helps everyone.

      • Posted by aparna on September 24, 2010 at 3:27 am

        Thanks a Lot Mr Lakshman. I was actually searching for these lyrics for quite sometime now.
        Meera I did translate these in to Devnagiri script using baraha. just some words here and there . I do have the audio format for these songs.. but not so clear. If u can give me ur email id i cud mail it to you


      • Posted by meeraghu on September 24, 2010 at 7:34 am

  234. Vidyabhushana has sung this song and it is available at


  235. Posted by Satish on September 26, 2010 at 10:46 am

    Do you have lyrics for baro raghavendra baro song and Hanuma Bheema Madhwa Muniya , If so can you post



    • hanumana bhIma madhva. rAgA: mOhana Eka tALA.

      P: hanumana bhIma madhva muniya nenedu badukirO
      A: anumAnangaLilladale manObhISTangalanIva
      C1: prANigaLa prANoddhAra jIvarOttamaru mattu prANApAna vyOnOdAna samAnaroLut-krSTa
      kANirEno kAya karma caSurindriyagaLige trANagoTTu salahuva jANa guru mukhya prANa
      2: kAmadhEnu cintAmaNi kalpa vrkSanAda svAmi prEmadindali neneyuvavara bhAgyakeNayuNTe
      sAmAnyavallavO Ida mOkSa sampadavigaLa dAta A maha aparOkSa jnAna dArDhya bhakti koDuva
      3: avatAra trayangaLalli hariya sEvisuta mattu tavakadinda pUjipa mahA mahimeyuLLavaro
      kavita vAkyavallavidu avivEka vendeNisa bEDi bhava bandhana kaLeva kAva purandara viTTalana dAsa


  236. Posted by Viswanath on September 27, 2010 at 2:01 am

    What is the meaning of PINAAYANO


  237. Posted by Dr. S.K.Deshpande on September 28, 2010 at 8:12 am

    Hello Madam,
    I am a teacher by Profession in an Agril. Univ., Dharwad, and a Madhwa Brahmin (Uttaradhi Mutt). Felt very nice to read Ur blog. I am searching 4 a long time audio version of Goddess Lakshmi song which reads as ” Valide Yatakamma Lakume Vasudevaga….”. Some thing like that. I have the lyrics of it but no audio version and Raaga of the song. If u find audio version of it pl. post it for me.


    • Posted by murthy on January 1, 2011 at 2:59 am

      Hello sanjeev,

      I was also searching for the song for long.If you have the lyrics of it please post it to me.And if you have found audio please post it along.

      Thanks and regards,


  238. Posted by Viswanath on October 1, 2010 at 4:02 am

    Please provide me with the lyrics for “palise parvathi enna…..”. I am not sure who has written it and my guess is either purandara dasaru or vittala dasaru.


  239. Posted by meeraghu on October 3, 2010 at 9:56 am

    Let me check to see if I have the lyrics.


  240. Posted by Geeta Vedanti on October 11, 2010 at 1:43 pm

    Hi Mira,
    Do you know short recitable Venkatesha Kalyana especially during Navratri? I found one by Shri Vadirajru in website, forgot to store it- now i cannot locate.

    Happy Navaratri


  241. Posted by Nagashree on October 13, 2010 at 2:27 am

    Hi meera,

    Could u please post the lyrics of the song “palisamma muddu sharade, yenna naligeyalli tappu baarade”[ I think written by Purandara Dasaru]…..



  242. Posted by Nagashree on October 13, 2010 at 3:23 am

    To add to the above comment, if possible could u please post different “ashtottara shathanamavali” in Kannada for different Gods like shiva, gowri, vishnu, lakshmi,saraswathi, dattatreya, anjaneya etc. 🙂

    Thanks and regards,


  243. Posted by Lakshman on October 13, 2010 at 8:45 am

    pAlisemma muddu shArade. rAgA: mukhAri. jhampe tALA.

    P: pAlisemma muddu shArade enna nAligEyali nilla bArade
    A: lOla lOcane tAye niruta nambide ninna
    C1: akSarakSara vivEkava ninna kukSiyoLIrELu lOkava sAkSAt rUpadinda olidu rakSisu tAye
    2: shrngArapura nelevAsini dEvi sangIta gAna vilASini mangaLa gAtre tAye bhaLire brahmana rANi
    3: sarvAlankAra dayA mUruti ninna caraNava stutisuve kIruti gurumUrti purandara viTTalanna stutisuta


  244. Posted by Veena on October 15, 2010 at 12:39 am

    Hi Meera,

    I am looking for the lyrics of the song “Nadedu bariya bhava kadalege kumba sambhava”.

    If you have it then can you plz send it to me.



  245. Posted by Gayatri on October 26, 2010 at 9:05 pm


    I am looking for lyrics to –

    1. Yaava Koolavo Ranga Yaava Koolavo

    2. Yadava Nee Baa Yedukula Ranga

    Please upload the same, if you have it.



    • It this one of the songs?

      yAdava nI bA. rAgA: kAmbhOji/AbhOgi. Eka/Adi tALA.

      P: yAdava nI bA yadukula nandana mAdhava madhusUdana bArO
      A: sOdara mAvana madhureli maDuhida yashOde kandane nI bArO
      C!: shankha cakravu kayyali hoLeyuta binkada gOvaLa nI bArO
      akaLanka mahimane Adi nArAyaNa bEkemba bhaktarigoli bArO
      2: kaNakAladuge gejje ghulu ghulurenutali jhaNa jhaNa vENu nADadali
      ciNIkOla ceNDu bugariyanADuta saNNa saNNa gOvaLaroDagUDi
      3: khaga vAhanane bage bage rUpane nagumogadarasane nI bArO
      jagadoLu ninnaya mahimeya pogaLuve purandara viTTala nI bArO


  246. Posted by Rama on October 27, 2010 at 1:24 am

    Hello madam,
    I am trying to get the lyrics for “Satata paalisu enna yati Raghavendra”. I am unable to find it anywhere from the sources I know… Can you or some one who visits the blog please post the lyrics for this song?


  247. Posted by Sathya on October 29, 2010 at 7:59 pm

    my ajji used to sing a tulasi pooje song which starts like “Dhruapathi maadidalu tulasi ya pooje..Kaantheyaru koodi” Do you know this song? If you know, please post it in English…..


  248. Posted by Surekha on November 4, 2010 at 11:22 am

    If you know the song…”Mangalaaratiya yettidalu…” could you please post that too.



  249. Dear all,
    any body can Help me to get Kanakadara Stotram Lyrics in MALAYALAM.


  250. Posted by Vidhu on November 7, 2010 at 1:06 pm

    Hey Meera,

    Happy Diwali:-))))

    I wanted to learn the song “lakshmi rave ma intiki” but cudn’t find the lyrics that easily. So I wanted to have the lyrics shared with U so that U can post it in your blogs & people can have easy access to the song.

    rAga: mAyAmALavagauLA tALa: caturaShra EkaM

    p. lakshmI rAvE mA iNTiki kshIrAbdhi putri vara (lakshmI)

    a. lakshmI rAvE mA iNTiki rAjitamuga nela konna
    sUkshmamuga mOkshamiccu sundari br.ndAvanadhAri

    c1. kungkuma paccakastUri kOrika tORu gOrOjanamu
    gOru aivvAjulu angita muganE alaru gandhamu
    cula gandhaM santa muga sAmbrANi dhUpamu
    mAtA nIku prItikA prakhyAdikA samarppintu namma

    c2. paShupu akshatalu parimaLa gandhamu
    panca bilvamulu pUrNa kalaShamu
    mAtA nIku prItikA prakhyAdikA samarppintu namma

    c3.guNDu mallE samara gAnu daNDiga cAmandi pUlu
    mElaina pArijAtamu
    mAtA nIku prItikA prakhyAdikA samarppintu namma

    c4. andamuga jarincu panca
    kundanambu paccani ravika
    candaTika sAmbrANi dhUpamu
    mAtA nIku prItikA prakhyAdikA samarppintu namma

    Pls find the below link to hear this beautiful song..



    • Posted by meeraghu on November 8, 2010 at 9:51 am

      What languages is this? Telugu?


      • lakSmi rave mA iNTiki. rAga: mAyAmALavagauLA. c/Eka tALA.

        p. lakshmI rAvE mA iNTiki kshIrAbdhi putri vara (lakshmI)
        a. lakshmI rAvE mA iNTiki rAjitamuga nela konna
        sUkshmamuga mOkshamiccu sundari br.ndAvanadhAri
        c1. kungkuma paccakastUri kOrika tORu gOrOjanamu
        gOru aivvAjulu angita muganE alaru gandhamu
        cula gandhaM santa muga sAmbrANi dhUpamu
        mAtA nIku prItikA prakhyAdikA samarppintu namma
        c2. paShupu akshatalu parimaLa gandhamu
        panca bilvamulu pUrNa kalaShamu
        mAtA nIku prItikA prakhyAdikA samarppintu namma
        c3.guNDu mallE samara gAnu daNDiga cAmandi pUlu
        mElaina pArijAtamu
        mAtA nIku prItikA prakhyAdikA samarppintu namma
        c4. andamuga jarincu panca
        kundanambu paccani ravika
        candaTika sAmbrANi dhUpamu
        mAtA nIku prItikA prakhyAdikA samarppintu namma

  251. Posted by Sanjeev on November 13, 2010 at 12:42 pm

    Dear Madam,

    Can you post the lyrics of Shri Hari Vayustuti in English?

    With warm regards



  252. Posted by Rupa on November 18, 2010 at 5:09 pm

    This is a wonderful site. Thanks for uploading. Do you have the lyrics for ‘Kanakadhaara stotram” in Kannada?


  253. Posted by Vidyadheesha on November 30, 2010 at 12:17 am

    madam can you find and post this song “vaibhavave namma vamana murthige” by Sri Purandaradasaru


  254. shObhavavE idu. rAgA: saurASTra. Adi tALA.

    P: shObhanavE idu shObhanavE
    A: vaibhavavE namma vAmana mUrtige
    C!: pAlugaDalu maneyoLagiralu ondAladeleya mEle malaguvare
    mUrlOkava ninnutaradoLimbiTTu muddu bAlakanAgi ettisi kombare
    2: siri ninna kai vashavAgiralu tirivare baliya dAnava bEDi
    sarasijabhava ninna pUje mADutlire narana baNDiya pOvanAguvre
    3: kammagOlana pitanAgiralu summane kubujage sOluvare


  255. Sorry the last line did not appear in the above message:

    bomma mUruti ninageNeyuNTe trijagadi hammina dEva purandara viTTala


  256. Posted by NALINA D.S on December 3, 2010 at 6:43 am

    madam meera very useful website may god give u all stregnth to collect many more such colections . i am frequent visitor of this site. i am searching for nodiramma neevu nodire song lyrics please if you have post it bye


  257. Posted by Jayanth on December 4, 2010 at 11:45 am

    Hello Meera,
    Do you have the lyrics of the song “Sri Guru Madhva rayarige namo namo….”. Would prefer to have this either in english or hindi or telugu.


  258. guru madhva rAyarigE namO namO guru madhva santatigeE namO namO
    shrIpAdarAjarigE guru vyAsarAjarigeE guru vAdirAjarigE namO namO
    rAghavendra rAyarigE vaikunTha dAsarigE purandara dAsarigE namO namO
    guru vijaya dAsarigE bhAgaNNa dAsarigE shrI ranga valida dAsarigE namO namO
    parama vairAgyashAli timmaNNa dAsarigE hunTekAra dAsarigE namO namO
    guru shrIsha viTTalanna parama bhaktara caraNa sarasija yugagalige namO namO


  259. Posted by Nagashree on December 7, 2010 at 1:48 am

    Hi Meera,

    Good to see new updates in your blog after a break..!!!!!! 🙂

    If possible can u please post lyrics of the song “Sakala Grahabala Neene Sarasijaaksha” by guru purandara dasaru in kannada.. If have 1 in english but few words are not very clear….

    Kindly post the same..

    Thanks and Regards,


    • sakala graha bala nInE. rAgA: aThANA. k/cApu tALA..

      P: sakala graha bala nInE sarasijAkSa
      A: nikhiLa rakSaka (or vyApaka)) nInE vishva vyApanE
      C1: ravicandra budha nInE rAhu kEtuvu nInE kavi guruvu shaniyu mangaLanu nInE
      diva rAtriyu nInE nava vidhAnavu nInE bhavarOga hara nInE bESajanu nInE
      2: pakSa mAsavu nInE parva kAlavu nInE nakSatra yOga tithi karaNagaLu nInE
      akSayavendu draupadiya mAnava kAida pakSi vAhana dIna rakSakanu nIne
      3: rtu vatsaravu nIne vrta yugAdiyu nInE kratuvu hOma yagnya sadgatiyu nInE
      jitavAgi ennoDeya purandara viTTalane shrutigE silukada mahA mahimanu nInE


  260. hi madam plse suggest me that how u all maintain all these websites in ur daily life….really m very happy to have u all as around in world…..all the best madam …. i am also doing BCA in 6th semester in BIJAPUR(KARNATAKA)


  261. Posted by Priya.Dixit on December 28, 2010 at 4:34 am

    Hi Meera!
    This is priya from Hubli! you are doing a fabulous and a great job. Keep it up! May god bless you with all hapiness in life! could you please post the lyrics of “Raya Baro tande tayi baro”.

    Thanks& Regards


  262. Posted by Priya.Dixit on December 28, 2010 at 4:36 am

    Meera! Sorry I want the lyrics in English:)


    • rAya bArO tande tAyi bArO. rAgA: Anandabhairavi/pIlu. Adi/kaharvA tALA. Jagannathadasa.

      P: rAya bArO tande tAyi bArO namma kAya bArO
      mAyigaLa mardisida rAghavEndra rAya bArO
      C1: vondipa janarige mandAra taruvante kundagabhISTava salisutippa rAya bArO
      kundadabhIStava salisutippa sarvajna mandanna matige rAghavEndra rAya bArO
      2: Aru mUru Elu nAlku eNtu grantha sArArtha tOridi sarvarige nyAyadinda rAya bArO
      tOridi sarvarige nyAyadinda sarvajna sUrigaLa rasane rAghavEndra rAya bArO
      3: rAma pada sarasIruha bhrnga krpApAnga bhrAmaka janara matabhanga rAya bArO
      bhrAmaka janara matabhanga mADida dhImantaroDeyane rAghavEndra rAya bArO
      4: bhUtaLa nAthane bhItiya biDisdi prEtatva kaLedi mahishiya rAya bArO
      prEtatva kaLedi mahishiya shrI jagannAtha viThalana prIti pAtra rAya bArO


  263. Posted by Jenisha on January 9, 2011 at 3:16 pm

    I need the amba chalisa lyrics in english


  264. Posted by Jenisha on January 9, 2011 at 3:17 pm

    I need the amba chalisa lyrics in Gujurati


  265. Posted by anirudha acharya on January 13, 2011 at 7:46 am


    Can you Please publish ADITHYA HRUDAYA MANTHRA lyrics in Kannada. Or atleast let me know where it is available.


  266. Posted by SURYA PRASAD C A on January 15, 2011 at 12:02 am

    Can some 1 give me lyrics of Yellaru maduvudu hottegagi from Sri Kanakadasaru……


  267. Posted by shruthi on January 20, 2011 at 5:19 am

    pls provide me the kannada hanuman chalis,,,its not dislplaying.pls


  268. Posted by shruthi on January 21, 2011 at 3:27 pm

    can anyone please tell me where i can find the stotra that we chant when we lose our valuable things…cause i rememeber to have read that stotra on this website and now i cannot find it.


  269. Posted by shruthi on January 21, 2011 at 3:31 pm

    Dear Meera,

    Can you please tell me where i can find the stotra that we usually chant when we lose our valuable belonging???i remember to have read that full stotra on your blog and now i cannot find it…can you please let me know about that stotra??

    thank you


  270. Posted by meeraghu on January 22, 2011 at 8:18 am

    Attached is the link where the stotra is posted.


  271. Posted by Dr Srinivas on January 26, 2011 at 7:31 am

    Hello madam,
    we apprciate your involvement and shocked to see your volume of work,keep it up !!!
    pl post jayamangala shubha mangala and bhjagovindam in kannada lyrics


  272. Posted by shruthi on January 26, 2011 at 9:00 am

    Thank you Meera


  273. Posted by Padmapranesh on January 28, 2011 at 12:30 pm

    Hello Meera,

    I am going through your blog for sometime and really appreciate all your efforts. Your blog is so interesting with lots of information about Rayaru, madhwacharya etc. Our family is a great devotee of Rayaru. I live in Longisland, Newyork.

    Last week when I was looking at the lyrics page, I saw the song”Krishna nee begane baro” lyrics both in kannada and English. But when I do it now, that song link takes me to another song “Krishna baro sri krishna baro” which has only kannada lyrics. Eventhough I am a kannada madhwa, I am from Madras. I do not know to read kannada scripts. I can only speak kannada. Can you please look into it and reply me. Also, I appreciate if you could please post the “krishna nee begane baro ” lyrics.

    Thanks a lot for your great work.


    • krSNA nI bEganE. rAgA: yamunAkalyANi. cApu tALA. Composer: Vyasaraya.

      P: krSNA nI bEganE bArO
      A: bEganE bArO mukhavanu tOrO
      C1: kAlalandigE gejjE nIlada bAvuli nIla varNanE nATyavADuta bArO
      2: uDiyalli uDi gejjE beralalli ungura koraLolu hAkida vaijayanti mAlA
      3: kAshi pItAmbara kaiyalli koLalu pUsita shrI gandha maiyOLagamma
      4: tAyigE bAyalli jagavannu tOrida jagadOddhAraka namma uDupi shrI krSNa


      P: O krSNA! Please come fast
      A: Please come fast and show your face
      C1: Wearing anklets on the feet, come dancing O blue hued one!
      2: Wearing the gold belt on the waist, rings on the fingers and the chrysanthymum garland on the neck
      3: Wearing the golden garment, with the flute in your hand, and perfumed sandal paste all over your body
      4: You who showed your mother the whole universe in your mouth, You, Protector of the world, O Udupi KrSNA!


      • Posted by Padmapranesh on February 5, 2011 at 1:15 pm

        Hi Mr.Lakshman,

        Thanks a lot for the lyrics of “Krishna nee begane baro”.
        I really appreciate it.

  274. Posted by Prasanna L on February 1, 2011 at 12:17 pm


    What a great work.. Really appreciating your efforts. Can you please upload lyrics of ‘Aluvudhyathakko Renga’ by Sri Purandaradaasaru in Kannada and English.

    Prasanna L


    • aLuvudyAtako ranga. rAgA: dEshyatODi. aTa tALA.

      P: aLuvudyAtako ranga attaranjipa gumma
      C1: huTTidELu divasadali duSTa pUtaniya konde muSTi
      viSada moleyuNDa kAraNa drSTi tAgite ninage rangayya
      2: turuva kAyalu pOgi paradIndra maLe kareya beraLali
      bettava negahida kAraNa beraLu uLugide ninage rangayya
      3: bAlakadanadalli gOpAlakarOdanADi kALiya maDuva
      kalagida kAraNa kAlu nondite ninage rangayya
      4: vasudEva sutanAgi asura mallara kondu kasuvina
      kamsana konda kAraNa kisaru tAgite ninage rangayya
      5: sharaNu vElApurada doreya cennigarAya sharaNara
      salahuva karuNAnidhiyE varada purandara viTTalarAya


  275. Posted by Nagashree on February 1, 2011 at 11:23 pm

    Thanks Lakshman for providing lyrics for various songs.. All devotional song lyrics are in your finger tips i think. Great ! 🙂

    @Meera: Thanks for such an informative site.. 🙂


  276. Posted by Bhargavi Shankar on February 9, 2011 at 12:14 am

    Dear Madam,
    I would like to request you to upload the lyrics of Ambashtaka.
    Amba shambhavi chandramauli rabalaparana
    Uma parvathi kaali Hymavathi Shiva trinayani
    kathyayini Bhairavi saavithi, navayauvana shubhakari, saamrajya lakshmi prada chidroopi paradevatha shri raajaraajeshwari.

    Thus goes the ashtakam
    Kindly upload it.


  277. Rajarajevariashtakam

    Ambha sambhavi chandramouli rabhala aparna uma paarvathii
    Kaali haimavathi shiva thrinayanaa kaathyayani bhairavi
    Savithri navayowvana subhaghari saam rajya lakshmi pradha
    Chitrubhi paradevatha bhagavathi sri rajarajeshwari 1

    Ambha mohini devathaa thribhuvanani aanandhasandhayini
    Vaani pallava bhaani venu murali ghanapriya lolinii
    Kalyanee uduraaja bhimbhavadana dhoomratcha samharinii
    Chitrubhi paradevatha bhagavathi sri rajarajeshwari 2

    Ambha noopura rathna kankanadhari keyoora haaraavali
    Jaadhi shambhagha vyjayanthi laharii kryveyagai raajithaa
    Veena venu vinodha manditha karaa veeraasaney samsthithaa
    Chitrubhi paradevatha bhagavathi sri rajarajeshwari 3

    Ambha routhrini bhadrakaali pagalaa jwaalaamukhi vaishnavi
    Brahmaani thripuraandhaki suranudhaa dedeepya manojwala
    Chaamundaachridha ratcha bhosha janani daatchayani vallavi
    Chitrubhi paradevatha bhagavathi sri rajarajeshwari 4

    Ambha kula dhanuhu : kasaangusadhari arthendhu bhimbhaadari
    Varaahi madhu kaidhabha prasamani vaani ramaa sevithaa
    Mallaathyaasuraha mughadaithya mdani maaheshwari shambhiga
    Chitrubhi paradevatha bhagavathi sri rajarajeshwari 5

    Ambha srishti vinaasa paalanakari aarya visam sobhithaa
    Gaayathri pranvaatcharaamrudharasa: pooranaanu sandhi kridha
    Omkaari vinadhasudaarchidapadaa uththanda daithyabhahaa
    Chitrubhi paradevatha bhagavathi sri rajarajeshwari 6

    Ambha saasvadha aagamaadi vinudhaa aarya mahadevathaa
    Ya brahmaadi, bibeelikaan janadadhi yaavai jagan mohini
    Ya panjapranavaadhi repaajanani ya chithkala maalini
    Chitrubhi paradevatha bhagavathi sri rajarajeshwari 7

    Ambha paalitha bhaktha raaja danisam ambaastagam yaha padeth
    Ambha lolaa kadatcha veetcha lalithanjaiswarya mavyahadam
    Ambha pavana manthra raaja padana thandesa motcha pradha
    Chitrubhi paradevatha bhagavathi sri rajarajeshwari 8


  278. Posted by meeraghu on February 9, 2011 at 7:27 pm

    Thanks so much, Lakshman. What language is this? And who is the composer?


  279. Meera: It is in samskrt and I posted the lyrics from the first site I located. Here is a better version. I don’t know who the composer is.


    ambA shAmbhavi candramaulirabalA.aparNA umA pArvatI
    kAlI haimavatI shivA trinayanI kAtyAyanI bhairavI |
    sAvitrI navayauvanA shubhakarI sAmrAjyalakShmIpradA
    cidrUpI paradevatA bhagavatI shrIrAjarAjeshvarI || 1 ||

    ambA mohini devatA tribhuvanI AnandasandAyinI
    vANI pallavapANiveNumuralIgAnapriyA lolinI |
    kalyANI uDurAjabimbavadanA dhUmrAkShasaMhAriNI
    cidrUpI paradevatA bhagavatI shrIrAjarAjeshvarI || 2 ||

    ambA nUpuraratnakaN^kaNadharI keyUrahArAvalI
    jAtIcampakavaijayantilaharI graiveyakairAjitA |
    vINAveNuvinodamaNDitakarA vIrAsane saMsthitA
    cidrUpI paradevatA bhagavatI shrIrAjarAjeshvarI || 3 ||

    ambA raudriNi bhadrakAli bagalA jvAlAmukhI vaiShNavI
    brahmANI tripurAntakI suranutA dedIpyamAnojvalA |
    cAmuNDA shritarakShapoShajananI dAkShAyaNI vallavI
    cidrUpI paradevatA bhagavatI shrIrAjarAjeshvarI || 4 ||

    ambA shUladhanuH kashAN^kushadharI ardhendubimbAdharI
    vArAhI madhukaiTabhaprashamanI vANIramAsevitA |
    malladyAsuramUkadaityamathanI mAheshvarI cAmbikA
    cidrUpI paradevatA bhagavatI shrIrAjarAjeshvarI || 5 ||

    ambA s.rShTavinAshapAlanakarI AryA visaMshobhitA gAyatrI
    praNavAkSharAm.rtarasaH pUrNAnusandhI k.rtA|
    oMkArI vinatAsutArcitapadA uddaNDadaityApahA
    cidrUpI paradevatA bhagavatI shrIrAjarAjeshvarI || 6 ||

    ambA shAshvata AgamAdivinutA AryA mahAdevatA
    yA brahmAdipipIlikAntajananI yA vai jaganmohinI |
    yA pa~ncapraNavAdirephajananI yA citkalA mAlinI
    cidrUpI paradevatA bhagavatI shrIrAjarAjeshvarI || 7 ||

    ambApAlitabhaktarAjadanishaM ambAShTakaM yaH paThet
    ambAlolakaTAkShavIkShalalitaM caishvaryamavyAhatam |
    ambA pAvanamantrarAjapaThanAdante ca mokShapradA
    cidrUpI paradevatA bhagavatI shrIrAjarAjeshvarI || 8 ||

    || iti shrIrAjarAjeshvaryaShTakaM saMpUrNam ||


  280. Posted by nagashree on February 15, 2011 at 5:38 am

    HI Meera,

    In a shiva temple nearby i heard people singing a song on Lord Shiva which starts something with “Om Namah Shivaya” it has complete explanation of Om Namaha shivaya mantra in the form of a song.. If u/lakshman has that lyrics kindly post it… Also pls post lyrics of song “mangalam gurushri chandramouleshwarage shakthi ganapathy sharadambege shankaracharyarige…………”.



  281. Posted by vijaya on February 20, 2011 at 1:25 am

    Dear Meera subbarao,
    Madam, I recently stumbled upon this website while browsing the net and found this site very interesting.Particularly for Madhwas. I would like to have the lyrics NANDA KANDA GOVINDA POOJIPADO ANANDAVADA MITAYEE – PURANDARADASA KRUTI AND ALSO THE ARATHI SONG ARATHI THA KRISHNAMURTHIGE, MURUTHIGE PARTHASARATHIGE”.



    • nanda tanaya gOvindana. rAgA: khamAs / bAgeshrI. khaNDacApu tALA.

      P: nanda tanaya gOvindana bhajipudu AnandavAda miThAyi
      A: bandhagaLanu bhava rOgagaLellvanU nindipadI miThAyi
      C1: dadhi ghrta kSIrakkintalu idu bahu adhikavAda miThAyi
      kadaLi drAkSi kharhjUra rasagaLanu mIruvudI miThAyi
      2: panca bhakSyangaLa SaD rasAnnagaLa mincidantha miThAyi
      kancIshane rakSisu endusiruvaru anjike biDipa miThayi
      3: japa tapa sAdhanangaLigindalu bahu aparUpada miThAyi
      jipuNa matigaLige sAdhyavilladiha purandara viTTala miThAyi


  282. Posted by vijaya on February 24, 2011 at 4:45 am

    Thank a ton Shri Lakshman for the lyrics of the song Nanda Tanaya


  283. Posted by Anita Dhillon on March 3, 2011 at 5:02 pm

    Sat Nam!

    I’m in need of knowing how the full Adi Shakti mantra looks in it’s original language, I’m thinking it’s probably Sanskrit, but it may be Gurmukhi. Can you help me? This is the full Americanized transliteration of what I’m after:



  284. Posted by Dhananjaya on March 5, 2011 at 10:24 am

    Can someone write the translation of the song raghavendra yathi saarva bourma by sri jagannatha dasaru in english? It will help me to do bhajans by understanding the meaning. There are some sanskrit words which layman cannot understand. Atleast meaning of the sentences is also great. You can email me at


  285. Here are lyrics so that someone can provide the translation.

    rAghavEndra yati. rAgA: dhanyAsi/bilAval. Adi/kaharvA tALA.

    P: rAghavEndra yati sArvabhauma duritaugha dUra tE namO namO
    mAgadharIpumata sAgara mIna mahAgha vinAshana namO namO
    A: shlAgita guNagaNa sUri prasanga sadAgamajna tE namO namO
    mEgha shyAmala rAmArAdaka mOgha bOdha tE namO namO
    C1: tungabhadra sutarangiNi tIraga mangaLa carita shubhAnga namO
    ingitajna kALinga mardhana yadupungava hrdaya turanga namO
    sangira cihnita shrngArAnana tingaLa karuNApAnga namO
    gAngEya sama bhAnga kumata mAtanga sangha citapinga namO
    2: kOvida mastaka shObhita maNI smbhAvita mahima pAlayamAm
    sEvApara sarvArthaprada brndAvana mandira pAlayamAm
    bhAvaja mArgaNa bhujaga vinAyaka bhAvajna priya pAlaya mAm
    kEvala nutajana pAvana rUpa sadA vinOdi hE pAlaya mAm
    3: shrI sudhIndra karajAta namO namO bhUsura vinuta vikhyAta namO namO
    dEshika vara samsEvya namO namO dOSa vivarjita kAvya namO
    klEshita jana paripala namO namO bhUSita karuNA shIla namO
    vyAsarAya pada bhakta namO namO shAsvata dharmAsakta namO
    4: sannuta mahima shrI jagannAtha viThala sahnita mAnasa jaya jaya bhO
    cihnita daNDa kamaNDala puNDra prapanna bhayApaha jaya jaya bhO
    mAnya mahAtma prasanna vadana kAruNyapayOnidhi jaya jaya bhO
    dhanya kSEma sampannadharAmara sharaNya sadArthita jaya jaya bhO


  286. Posted by Rajesh on March 11, 2011 at 10:25 am

    Very Nice compilation at one place. Very good work done.Congrats, Keep it up. Made use of it very much.
    Please can some one provide me lyrics of “Intha Prabhuva Kaaneno” by Shri Vijaya Vittala. Thank you in advance.


  287. The audio for this song is available here:
    But with my limited knowledge of kannada I am not able to write down the correct words.



  288. Posted by piyush dubey on March 14, 2011 at 12:09 am

    It’s realy good to have the lyrics in Sanskrit .

    thanks to you


  289. inthA prabhuva kANEno, Vijayadasa.

    P: inthA prabhuva kANeno I jagadoLaginthA prabhuva kANeno
    A: inthA prabhuva kANe shAnta mUruti jagadantaranganu lakSmIkAnta sarvAntaryAmi
    C1: bEDida varava koDuva bhaktara tappu nODade bandu poreva gADikAranu garuDA
    rUDha guNavanta mahA prauDha pratApa jagadi gUDadi sancaripa
    pADi hogaLi koNDADuvara mundADutalippanu kADoLagiddaru
    kEDiganE nADADigaLandadi IDunTEnO I venkaTage
    2: nigama tatigaLariyada nIraja bhavAdya gaNita suraru kANada jagadoDeyanu bhaktA
    digaLigolidu tristhA nagaLa tyajisi kali yugadi bhUmige bandu
    agaNita suguNArNava shrI hariyE jagadoLu sEvAdigaLanu koLutiha
    aghahara mOkSAdigaLa koDutiha nagemogada cenniganiMtihano
    3: bhArgava bhUmivallabha bhavadUra bhaktavargake sulabha nirguNa nirvikAra
    svargadaishvaryakintA narghya sampadavIva dIrghAyuvantanIta
    bhArgavarAma nrupargaLanellaraNAgradi jayisida ugrapratApa su
    rAgragaNya sadvigraha shrImad anugraha mADuta durguNa kaLeva
    4: nirduhkhAnanda bharitA nirvANa sukhake Ardrahrudaya tOruta nidreyoLiddavagu
    padravapaDisida kSUdra daityanna kondu subhadra jagake itta
    nirdayanalla samudrashayana gOvardhana giriyanu uddharisida yadu
    vardhana danuja vimardana lakSmIjanArdhana vara shESAdri nivAsa
    5: sarasijAsana manmatha Irvaru sutaru suratarangiNi tanuje puravE vaikuNTha indrAdya
    mararu kinkararu garuDavAhana uraga paryanka niSkaLanka
    saridoregaLa nAnariyenu venkaTagiriyali mereyuva karuNegaLarasane
    mareyade poreyuva sharaNAgataranu marutAntargata siri vijayaviThThala


    • Posted by Rajesh on March 18, 2011 at 10:04 am

      Thank you very much for the lyrics of Intha Prabhuva Kaaneno…
      Nice work done here. Keep it up. Thank you once again.


  290. Posted by v.k.sivakami on March 29, 2011 at 4:01 am

    sir, I wish to have the lyrics of deva devam of Narayana theertha.I presume it is in ragam sindhu bhairavi.I will be thankful to you if you let me know via email.


  291. Posted by Kavya J on March 30, 2011 at 2:54 am

    Hi Meera,

    I just googled for Shri Raghavendra Ashtotra Shathanamavali lyrics & found this site listed. Now for the past 2 days I am going through a lot of content posted here. It is a wonderful effort & thanks for maintaining it so well.

    Looking forward to more such information regarding our culture.



  292. dEva dEvam vEditam mrgayAma bhayamiha. rAgA: sindhubhairavi. cApu tALA.

    P: dEva dEvam vEditam mrgayAma bhayamiha
    A: drshya vastu sudhrtayA satatam sati pratibhAti pratyagAtma yApi bhUtiSu nityamEva punAti bhayamiha
    C1: prANa buddhi layOdayAdapi vAsayAtyamalEnA svaprakAsha sukhAt-manOdaya hAnidhi rahitEna bhayamiha
    2: vEda bhAga vicAra jAtam atI priyA praNayEna varNitam shiva rAma tIrtha padAmbuja bhramarENa bhayamiha


  293. Posted by Sudheendra on April 3, 2011 at 4:44 am

    Dear friend,
    It is very helpful to sing a song with lyrics. Thanks for your efforts.

    Could you please get the lyrics of THAAYE KAAYE SHREE HARI JAAYE, KAAYE THAAYE SANTHOSHA VEEYE sung by Sri Puttur Narasimha Nayak. I just love this song but not able to get the cassette of CD also.


  294. Posted by Aarthi Jois on April 7, 2011 at 1:33 pm

    Can you please put the lyrics for the song “Angaladholu Raamanaadidha Chandra Bekkendhu thaa kunidhaadidha” song by KagineleAadhikeshava in English. It would be appropriate for the upcoming SriRaamaNavami. -Thanks,Aarthi


    • angaLadoLu rAmanADida. rAgA: AbhEri. Adi tALA. Kanakadasa.

      P: angaLadoLu rAmanADida candra bEkendu tA haTa mADidA
      C1: tAyiya karedu kai mADi tOridA mugila kaDegomme diTTisi nODida
      ciNikOLu caNDu buguri ellava bEDa bEDa endu tA visADidA
      2: kanda vA endu tAyi karedaLu mammu uNNEndu baNNisuttiddaLu
      tAyi kausalya kaLevaLe goNDalu kanda anjidanu ennu tiddaLu
      3: ALuva dhvani kELi rAjanu mantri sahitAgi dhAvisi bandanu
      niluva kannaDi tandiDisidA shrI rAmana etti muddADidA
      4: kannaDiyoLu bimba nODidA candra sikkidanendu kuNidADidA
      I sambhrama nODi Adi kEshava raghu vamsahavannE koNDADidA


  295. Posted by Sricharan on April 16, 2011 at 12:02 pm

    The link for Preenayamo Vasudevam stotra fails with the message ‘Page not found’. Please check if this problem persists at your end.


  296. Posted by udaya chandrika on April 17, 2011 at 11:18 pm

    can you please upload the lyrics of “ambashtakam”.
    thank you in advance.

    udaya chandrika


  297. Posted by Chandrashekhara Sharma on April 25, 2011 at 9:40 pm

    Can u please send me slokas on Lord Subrahmanya in Kannada script.



  298. Posted by V.Mahesh Kumar on April 25, 2011 at 9:44 pm

    Pl send me slokas of Lord Subrahmanya in Kannada script


  299. Posted by PARASHURAM SINGH on May 18, 2011 at 9:20 am

    Dear Madam,

    First of all i thank you for this website it is really very very help ful for all the Adyatimika People.
    I requre the below 2 slokas in Kannade
    1.Shiva Sharasa Namavali/shiva Namavalli
    2.Subramanya Ashotakkam.
    Please forward me in kannada version


  300. Posted by bindu on May 24, 2011 at 4:34 am




  301. Posted by vasundara krishnan on May 28, 2011 at 3:23 am


    I want the lyrics in Kannada.. I find only in english please let me know the link where all the lyrics are available in Kannada


  302. Posted by swathi on June 1, 2011 at 12:32 am

    hi, its very nice to see lyrics of many songs. i’m sure this will be very useful for many ppl. great work indeed!!.. i need lyrics of palavidu baaldudake(anu harikathamrutha sara).. if u have pl post it.. thank u so much:)


  303. Posted by Praveen on June 1, 2011 at 11:12 pm


    Can you please find and post on your website the lyrics for “Enu Madhale Thangi Timmayna padava naa kande”.



    • Ena hELali tangi. rAga: madhyamAvati. Adi tALA

      P: Ena hELali tangi timmayyana pAdavanu kaNDe
      A: kanasu kaNDene manadali kaLavaLagoNDene
      C1: honna kaDagavanniTTu timmayya tA kOlva nAmaviTTu
      anduge phalukenuta enna munde bandu nintiddanalle
      2: makara kuNDalavanniTTu timmayya tA kastUri tilakavanniTTu
      gejje ghalukenuta svAmiyu bandu nintiddanalle
      3: muttina pallakki yatigaLu hottu nintiddaralle
      chatra cAmaradinda rangayyana utsava mUrutiya
      4: tAmara kamaladalli kruSNayya tA bandu nintiddanalle
      vAyu bommAdigaLu rangayyana sEveya mADuvare
      5: navaratna kettisida svAmi enna hrudaya maNTapadalli
      sarvAbharaNadinda purandara viThalana kUDidane


  304. Posted by Murali Madhava on June 1, 2011 at 11:41 pm

    Please send me the lyric/SONG of the following song.



    • olide yAtakammA lakumI. rAgA: bAgEshrI. Adi tALA. Gopaladasa.

      P: olide yAtakammA lakumI vAsudEvagE
      A: halavandadavana avanE tiLidu tiLidu tiLidu tiLiyAdhAnga
      C1: kamala ganDhi kOmalAngi sundarsyA vadanE nInu
      ramaNa matsya kaThiNa kAya sUkarAsyanU
      ramaNIya svarUpi nInu amita ghOra rUpanavanu
      namipariSTa dAyi nInu dAnava bEDuvanigE nI
      2: jANe ratnAkarana magaLu tAnu shuddha bhrugu janavanu
      AnandAbja sadane nInu vanavAsI avanU
      mAnya pativrateyu nInu nAnA yOsiSTAni avanu
      jnAna citra vasanE nInu hIna caila nAdavanigE
      3: avana vArte kELidavaru ollarO samsAravannu
      avana mUrti nODi maneya hanava biDuvarO
      avanapurake pOva janaru ommiganda tirugi bararO
      avanu tAnE tanayarannu tannavayava dinda paDedavanige
      4: svayata anapEkSa kAmiyavanu nidrA hIna anAshana
      paruSarUpa vAkya shabda amita BhOktanu
      guru gOpAla viTThalanu niruta tanna vakSasthaLadoLu
      aramaNeya mADittu ninagE maralu mADida mAyA dEvI


  305. hai madam,
    this is rohit….can u plzzzz post the lyrics of lakshmi rave ma intiki lyrics?my e mail id is…please…


  306. I tried to post the lyrics but i get a message saying that it is a duplicate post.


  307. Posted by radhika on June 13, 2011 at 1:38 pm

    nice site, actually i need song of ” anandathirtharegye thumbhu santhsavembha”


  308. Posted by Pramodini on June 20, 2011 at 1:50 am


    Thanks for this site..This is very much informative for most of d lyrics..can u get me the full lyrics for “RAMANA AVATARA RAGHUKULA SOMANA AVATARA” song..



  309. Posted by lakshmi on July 3, 2011 at 8:42 pm

    I was looking for this song lyrics and found it, Thought it might be of interest.
    Shringapuradeeswari – Shrungapuradeeswari

    Shrunga Puradheeshwari Sharadhe
    Shubha Mangale Sarvaabheeshta Pradhe

    Shankara Sannuthe SHree Padma Charane
    Sakala Kalaa Vishaaradhe Varadhe
    Salahenna Thaaye Saama Gaana Priye

    Karunisemma Shruthi Gathigala Maathe
    Kamaneeya Saptha Swara Supoojithe
    Kaavya Gaana Kalaa Swaroopini
    Kaamitha Daayini Kalyani Janani


  310. The composer is A.V.Krishnamachar.


  311. If you all want to meet GOD then visit BRAHMA KUMARIS ISHVARIYA VISHVA Vidhyalya……. Centres near you


  312. Posted by Girija M.S on July 12, 2011 at 12:55 am

    Please publish Narasimha stotra and Runa vimochana stotram at your website

    Thank you



  313. Posted by bharathi on July 12, 2011 at 12:57 pm — scroll down to Narasimha Stotram
    There are several languages that you can select to view the script and there is an mp3 too to listen.
    One more powerful stotra is Mantraraajapada Stotram. link to this is also there

    kannada link

    I have the Runa vimochana – I will try to input that
    Regards Bharathi


  314. Posted by jay pillay on July 14, 2011 at 6:24 am

    Please, do you have the lyrics of shanmuga dyanam,subramanya mangalam and subramanya suprabatham..Thankyou


  315. Posted by Niranjana on July 17, 2011 at 3:07 pm

    Really Good Site !!!

    All the work behind this are highly noble and appreciated 🙂



  316. Posted by bharathi/lakshmi on July 17, 2011 at 11:10 pm

    Hi Girija,

    This is Bharathi here. M email is
    Here is the Runa vimochana sloka. O have word doc. I do mot know how to upload here. But I can send you if you provide your email
    Note :: I could view using Safari browser. Firefox did not render kannada on mac

    ದೇವತಾ ಕಾರ್ಯ ಸಿದ್ಯರ್ಥಂ ಸಭಾಸ್ಥಂಭ ಸಮುಧ್ಭವಂ
    ಶ್ರೀ ನೃಸಿಂಹಂ ಮಹಾವೀರಂ ನಮಾಮಿ ಋಣ ಮುಕ್ತಯೇ – ೧

    ಲಕ್ಷ್ಮ್ಯಾಲಿಂಗಿತ ವಾಮಾಂಗಂ ಭಕ್ತಾನಂ ವರದಾಯಕಂ
    ಶ್ರೀ ನೃಸಿಂಹಂ ಮಹಾವೀರಂ ನಮಾಮಿ ಋಣ ಮುಕ್ತಯೇ – ೨

    ಆಂತ್ರಮಾಲಧರಂ ಶಂಖಚಕ್ರಾಭ್ಜಾಯುಧ ಧಾರಿಣಂ
    ಶ್ರೀ ನೃಸಿಂಹಂ ಮಹಾವೀರಂ ನಮಾಮಿ ಋಣ ಮುಕ್ತಯೇ -೩

    ಸ್ಮರಣಾತ ಸರ್ವಪಾಪಗ್ನಂ ಖದ್ರೂಜ ವಿಷನಾಶನಂ
    ಶ್ರೀ ನೃಸಿಂಹಂ ಮಹಾವೀರಂ ನಮಾಮಿ ಋಣ ಮುಕ್ತಯೇ- ೪

    ಸಿಂಹನಾದೇನಮಹತ ದಿಗ್ದಂತಿ ಭಯನಾಶನಂ
    ಶ್ರೀ ನೃಸಿಂಹಂ ಮಹಾವೀರಂ ನಮಾಮಿ ಋಣ ಮುಕ್ತಯೇ- ೫

    ಪ್ರಹ್ಲಾದಂ ವರದಂ ಶ್ರೀಶಂ ಧೈತೇಶ್ವರ ವಿದಾರಿಣಂ
    ಶ್ರೀ ನೃಸಿಂಹಂ ಮಹಾವೀರಂ ನಮಾಮಿ ಋಣ ಮುಕ್ತಯೇ- ೬

    ಕ್ರೂರಗ್ರಹೈ ಪೀಡಿತಾನಂ ಭಕ್ತಾನಂ ಅಭಯಪ್ರದಂ
    ಶ್ರೀ ನೃಸಿಂಹಂ ಮಹಾವೀರಂ ನಮಾಮಿ ಋಣ ಮುಕ್ತಯೇ- ೭

    ವೇದವೇದಾಂತ ಯಜ್ಞೆಷಂ ಬ್ರಹ್ಮರುದ್ರಾದಿವಂದಿತಂ
    ಶ್ರೀ ನೃಸಿಂಹಂ ಮಹಾವೀರಂ ನಮಾಮಿ ಋಣ ಮುಕ್ತಯೇ- ೮

    ಯ ಇದಂ ಪಠತೇ ನಿತ್ಯಂ ಋಣ ಮೋಚನ ಸಂಹಿತಂ
    ಅನ್ರುಣಿ ಜಾಯತೇ ಸತ್ಯೋ ಧನಂ ಶೀಘ್ರಮವಾಪ್ನುಯತ್ – ೯


  317. Posted by umesh on July 18, 2011 at 7:10 am


    I need Lyrics of Hanuman Kavacham in Kannada. Can you please share it to below mail id.



  318. Posted by amma on July 20, 2011 at 1:51 am

    I have typed Kavacha in Kannada. It is eka mukha hanuman kavacha . there are other kavacha’s also.
    best regards Amma dumma
    ಹನುಮಾನ್ ಪೂವ೯ತಃ ಪಾತು ದಕ್ಷಿಣೇ ಪವನಾತ್ಮಜಃ
    ಪ್ರತೀಚ್ಯಾಂ ಪಾತುರಕ್ಷೋಙ ಉತ್ತರಸ್ಯಾಭ್ಧಿಂ ಪಾರಗಃ ।। ೧ ।।

    ಉದೀಚ್ಯಾಂ ಊದ್ವ೯ಗಃ ಪಾತು ಕೇಸರೀ ಪ್ರಿಯನಂದನಃ
    ಅಧಃಶ್ಚ ವಿಷ್ಣು ಭಕ್ತಸ್ತು ಪಾತು ಮದೆ್ಯೕತು ಪಾವನಿ ।। ೨ ।।

    ಅವಾಂತರ ದಿಶಃ ಪಾತು ಸೀತಾಶೋಕವಿನಾಶನಃ
    ಲಂಕಾವಿದಾಹಕಃ ಪಾತು ಸವಾ೯ಪದ್ ಭ್ಯೋ ನಿರಂತರಂ ।। ೩ ।।

    ಸುಗ್ರೀವ ಸಚಿವಪಾತು ಮಸ್ತಕಂ ವಾಯುನಂದನಃ
    ಭಾಲಂ ಪಾತು ಮಹಾವೀರೋ ಭ್ರುವೊರ್ಮಧ್ಯೇ ನಿರಂತರಂ ।। ೪ ।।

    ನೀತ್ರೇ ಛಾಯಾಪಹಾರೀ ಚ ಪಾತು ನಃ ಪ್ಲವಗೇಶ್ವರಃ
    ಕಪೊಲೌ ಕಣ೯ಮೂಲೇ ಚ ಪಾತು ಶ್ರೀರಾಮ ಕಿಂಕರಃ ।। ೫ ।।

    ನಾಸಾಗ್ರಮ್ ಅಂಜನೀಸೂನುವ೯ಕ್ತ್ರಂ ಪಾತು ಕಪೀಶ್ವರಃ
    ವಾಚಂ ರುದ್ರಪಿ್ರಯ ಪಾತು ಜಿಹ್ವಾಂ ಪಿಂಗಳ ಲೋಚನಃ ।। ೬ ।।

    ಪಾತು ದಂತಂ ಫಲ್ಗುಣೇಷ್ಟ ಸ್ಚುಂಬಕಂ ದೈತ್ಯ ಪ್ರಾಣಹೃತ್
    ಪಾತು ಕಂಠಶ್ಚ ದೈತ್ಯಾರಿಃ ಸ್ಕನ್ದೌ ಪಾತು ಸುರಾ೯ಚಿ ತಃ ।। ೭ ।।

    ಭುಜೌ ಪಾತು ಮಹಾ ತೇಜಾಃ ಕರೌತು ಚರಣಾಯುಧಃ
    ನಖಾಂನಖಾಯುಧ ಪಾತು ಕುಕ್ಷಿಂ ಪಾಕು ಕಪೀಶ್ವರಃ ।। ೮ ।।

    ವಕ್ಷೋ ಮುದ್ರಾಪಹಾರೀ ಚ ಪಾತು ಪಾ೯ಶೆ್ವೕ ಭುಜಾಯುಧಃ
    ಲಂಕಾವಿಭಂಜನಃ ಪಾತು ಪೃಷ್ಟದೀಶೀ ನಿರಂತರಂ ।। ೯ ।।

    ನಾಭಿಂ ಚ ರಾಮಧೂತೋಸು್ತ ಕಟಿಂ ಪಾತು ನಿಲಾತ್ಮಜಃ
    ಗುಹ್ಯಂ ಪಾತು ಮಹಾ ಪ್ರಾಜ್ಞಃ ಲಿಂಗಂ ಪಾತು ಶಿವಪ್ರಿಯಃ ।। ೧೦ ।।

    ಊರೂ ಚ ಜಾನುನೀ ಪಾತು ಲಂಕಾ ಪ್ರಾಸಾದ ಭಂಜನಃ
    ಜಂಗೇ ಪಾತು ಮಹಾಬಾಹು ಗುಲ್ಪೌ ಪಾತು ಮಹಾಬಲಃ ।। ೧೧ ।।

    ಅಚಲೋ ದಾ್ವರಕಃ ಪಾತು ಪಾದೌ ಭಾಸ್ಕರ ಸನ್ನಿಭಃ
    ಅಂಜನೀಸುತ ಸತಾ್ವಢ್ಯಃ ಪಾತು ಪಾದಾಂಗುಲೀಸ್ತಥಾ ।। ೧೨ ।।

    ಸ೯ವಾಂಗಾನಿ ಮಹಾವೀರಃ ಪಾತು ರೋಮಾಣಿ ಚಾತ್ಮವಾನ್
    ಹನುಮತ್ಕವಚಂ ಯಸ್ತು ಪಠೇದಿ್ವದಾ್ವನ್ ವಿಚಕ್ಷಣಃ ।। ೧೩ ।।

    ಶ್ರೀರಾಮಾದಾಗ್ರೇ ಹನುಮದಾಗ್ರೇ ಯಃ ಪಠೇಚ್ಚ ನರಃ ಸದಾ
    ಸಏವ ಪುರುಷಶ್ರೇಷ್ಟೋ ಭಕಿ್ತಂ ಮುಕ್ತಿಂ ಚ ವಿಂದತಿ ।। ೧೪ ।।

    ತ್ರಿಕಾಲಂ ಏಕಕಾಲಂವಾ ಪಠನ್ಮಾಸ ತ್ರಯಂ ನರಃ
    ಸವಾ೯ನ್ ರಿಪೂನ್ ಕ್ಷಣಾತ್ ಜಿತ್ವಾ ಸಪುಮಾನ್ ಶ್ರಿಯಂ ಆಪ್ನುಯಾತ್ ।।೧೫ ।।

    ಮಧ್ಯರಾತ್ರೇ ಜಲೇ ಸ್ಥಿತ್ವಾ ಸಪ್ತವಾರಂ ಪಠೇತ್ಯ ಯದಿ
    ಕ್ಷಯ ಅಪಸ್ಮಾರ ಕುಷ್ಟಾದಿ ತಾಪತ್ರಯ ನಿವಾರಣಂ ।। ೧೬ ।।

    ಅಶ್ವಥ್ಥ ಮೂಲೆ ಅಕ೯ ವಾರೆ ಸ್ಥಿತ್ವಾ ಪಠತಿ ಯ ಪುಮಾನ್
    ಅಚಲಂ ಶ್ರೀಯಮಾಪ್ನೋತಿ ಸಂಗ್ರಾಮೇ ವಿಜಯಂ ತದಾ ।। ೧೭ ।।

    ಲಿಖಿತ್ವಾ ಪೂಜಯೇತ್ ಯಸ್ತು ಸವ೯ತ್ರ ವಿಜಯೀ ಭವೇತ್
    ಯಾ ಕರೇ ಧಾರಯೇನ್ನಿತ್ಯಂ ಸಪುಮಾನ್ ಶಿ್ರೕಯಮಾಪ್ನುಯಾತ್ ।। ೧೮ ।।

    ಭುಧ್ಧಿ೯ಭಲಂ ಯಶೋ ಧೈರ್ಯಂ ನಿಭ೯ಯತ್ವಂ ಅರೋಗತಾ
    ಸುಧಾರಢ್ಯಂ ವಾಕ್ ಸ್ಪುಠತ್ವಂ ಚ ಹನೂಮದ್ ಸ್ಮರಣಾದ್ಭವೇತ್

    ಮಾರಣಂ ವೈರಿಣಂ ಸಾದ್ಯ ಶರಣಂ ಸವ೯ಸಂಪದಾಂ
    ಶೋಕಸ್ಯ ಹರಣೇ ದಕ್ಷಂ ವಂದೇ ತಂ ರಣ ದಾರುಣಂ

    ಸ್ಥಿತ್ವಾತು ಭಂದನೇನ ಯಸ್ತುಜಪಂ ಕರಯತಿ ದ್ವಿಜೈ
    ತಕ್ಷಣಾತ್ ಮುಕ್ತಿಮಾಪ್ನೊತಿ ಸತ್ಯಂ ಶ್ರೀರಾಮಭಾಷಿತಂ

    ಯ ಇದಂ ಪ್ರಾತರುತ್ಥಾಯ ಪಠೇತ್ ಕವಚಂ ಸದಾ
    ಆಯು್ಯರಾರೋಗ್ಯ ಸಂತಾನೈಸ್ತಥಾ ಸ್ತವ್ಯಸ್ತವೊ ಭವೇತ್

    ಇದಂ ಪೂರ್ವಂ ಪಠಿತ್ವಾತು ರಾಮಸ್ಯ ಕವಚಂ ತಥಾಃ
    ಪಠನೀಯಂ ನರೈ ಭಕ್ತ್ಯಾ ನೈಕಮೇವ ಪಠೇತ್ ಕಥಾ

    ಹನೂಮತ್ ಕವಚಂ ಚಾತ್ರ ಶಿ್ರೕರಾಮ ಕವಚಂ ವಿನಾ
    ಏ ಪದಂತಿ ನರ್ಚಾತ್ರಪದಾನಾಂ ತದ್ ವೃಥಾ ಭವೀತ್

    ತಸ್ಮಾದ್ ಸ್ಮರೈ ಪದನೀಯಮ್ ಸವಾ೯ದ್ ಕವಚ ದ್ವಯಂ
    ರಮಸ್ಯ ವಾಯುಪುತ್ರಾಯ ಶಭ್ದಕಥೈಶ್ಚ ವಿಷೇಶತಃ

    ಬ್ರಹ್ಮಾಂಡ ಪುರಾಣಾಂತರ್ ಗತೇ ನಾರದ ಅಗಸ್ತ್ಯ ಸಂವಾದೇ
    ಶ್ರೀರಾಮಚಂದ್ರ ಕಥಿತಂ ಪಂಚಮುಖೇಕ ಏಕ ಮುಖೀ ಹನುಮಾನ್ ಕವಚಂ
    ಓಂ ತತ್ ಸತ್ ನ


  319. Posted by amma on July 20, 2011 at 2:00 am

    ಹನುಮಾನ್ ಪೂವ೯ತಃ ಪಾತು ದಕ್ಷಿಣೇ ಪವನಾತ್ಮಜಃ
    ಪ್ರತೀಚ್ಯಾಂ ಪಾತುರಕ್ಷೋಙ ಉತ್ತರಸ್ಯಾಭ್ಧಿಂ ಪಾರಗಃ ।। ೧ ।।

    ಉದೀಚ್ಯಾಂ ಊದ್ವ೯ಗಃ ಪಾತು ಕೇಸರೀ ಪ್ರಿಯನಂದನಃ
    ಅಧಃಶ್ಚ ವಿಷ್ಣು ಭಕ್ತಸ್ತು ಪಾತು ಮದೆ್ಯೕತು ಪಾವನಿ ।। ೨ ।।

    ಅವಾಂತರ ದಿಶಃ ಪಾತು ಸೀತಾಶೋಕವಿನಾಶನಃ
    ಲಂಕಾವಿದಾಹಕಃ ಪಾತು ಸವಾ೯ಪದ್ ಭ್ಯೋ ನಿರಂತರಂ ।। ೩ ।।

    ಸುಗ್ರೀವ ಸಚಿವಪಾತು ಮಸ್ತಕಂ ವಾಯುನಂದನಃ
    ಭಾಲಂ ಪಾತು ಮಹಾವೀರೋ ಭ್ರುವೊರ್ಮಧ್ಯೇ ನಿರಂತರಂ ।। ೪ ।।

    ನೀತ್ರೇ ಛಾಯಾಪಹಾರೀ ಚ ಪಾತು ನಃ ಪ್ಲವಗೇಶ್ವರಃ
    ಕಪೊಲೌ ಕಣ೯ಮೂಲೇ ಚ ಪಾತು ಶ್ರೀರಾಮ ಕಿಂಕರಃ ।। ೫ ।।

    ನಾಸಾಗ್ರಮ್ ಅಂಜನೀಸೂನುವ೯ಕ್ತ್ರಂ ಪಾತು ಕಪೀಶ್ವರಃ
    ವಾಚಂ ರುದ್ರಪಿ್ರಯ ಪಾತು ಜಿಹ್ವಾಂ ಪಿಂಗಳ ಲೋಚನಃ ।। ೬ ।।

    ಪಾತು ದಂತಂ ಫಲ್ಗುಣೇಷ್ಟ ಸ್ಚುಂಬಕಂ ದೈತ್ಯ ಪ್ರಾಣಹೃತ್
    ಪಾತು ಕಂಠಶ್ಚ ದೈತ್ಯಾರಿಃ ಸ್ಕನ್ದೌ ಪಾತು ಸುರಾ೯ಚಿ ತಃ ।। ೭ ।।

    ಭುಜೌ ಪಾತು ಮಹಾ ತೇಜಾಃ ಕರೌತು ಚರಣಾಯುಧಃ
    ನಖಾಂನಖಾಯುಧ ಪಾತು ಕುಕ್ಷಿಂ ಪಾಕು ಕಪೀಶ್ವರಃ ।। ೮ ।।

    ವಕ್ಷೋ ಮುದ್ರಾಪಹಾರೀ ಚ ಪಾತು ಪಾ೯ಶೆ್ವೕ ಭುಜಾಯುಧಃ
    ಲಂಕಾವಿಭಂಜನಃ ಪಾತು ಪೃಷ್ಟದೀಶೀ ನಿರಂತರಂ ।। ೯ ।।

    ನಾಭಿಂ ಚ ರಾಮಧೂತೋಸು್ತ ಕಟಿಂ ಪಾತು ನಿಲಾತ್ಮಜಃ
    ಗುಹ್ಯಂ ಪಾತು ಮಹಾ ಪ್ರಾಜ್ಞಃ ಲಿಂಗಂ ಪಾತು ಶಿವಪ್ರಿಯಃ ।। ೧೦ ।।

    ಊರೂ ಚ ಜಾನುನೀ ಪಾತು ಲಂಕಾ ಪ್ರಾಸಾದ ಭಂಜನಃ
    ಜಂಗೇ ಪಾತು ಮಹಾಬಾಹು ಗುಲ್ಪೌ ಪಾತು ಮಹಾಬಲಃ ।। ೧೧ ।।

    ಅಚಲೋ ದಾ್ವರಕಃ ಪಾತು ಪಾದೌ ಭಾಸ್ಕರ ಸನ್ನಿಭಃ
    ಅಂಜನೀಸುತ ಸತಾ್ವಢ್ಯಃ ಪಾತು ಪಾದಾಂಗುಲೀಸ್ತಥಾ ।। ೧೨ ।।

    ಸ೯ವಾಂಗಾನಿ ಮಹಾವೀರಃ ಪಾತು ರೋಮಾಣಿ ಚಾತ್ಮವಾನ್
    ಹನುಮತ್ಕವಚಂ ಯಸ್ತು ಪಠೇದಿ್ವದಾ್ವನ್ ವಿಚಕ್ಷಣಃ ।। ೧೩ ।।

    ಶ್ರೀರಾಮಾದಾಗ್ರೇ ಹನುಮದಾಗ್ರೇ ಯಃ ಪಠೇಚ್ಚ ನರಃ ಸದಾ
    ಸಏವ ಪುರುಷಶ್ರೇಷ್ಟೋ ಭಕಿ್ತಂ ಮುಕ್ತಿಂ ಚ ವಿಂದತಿ ।। ೧೪ ।।

    ತ್ರಿಕಾಲಂ ಏಕಕಾಲಂವಾ ಪಠನ್ಮಾಸ ತ್ರಯಂ ನರಃ
    ಸವಾ೯ನ್ ರಿಪೂನ್ ಕ್ಷಣಾತ್ ಜಿತ್ವಾ ಸಪುಮಾನ್ ಶ್ರಿಯಂ ಆಪ್ನುಯಾತ್ ।।೧೫ ।।

    ಮಧ್ಯರಾತ್ರೇ ಜಲೇ ಸ್ಥಿತ್ವಾ ಸಪ್ತವಾರಂ ಪಠೇತ್ಯ ಯದಿ
    ಕ್ಷಯ ಅಪಸ್ಮಾರ ಕುಷ್ಟಾದಿ ತಾಪತ್ರಯ ನಿವಾರಣಂ ।। ೧೬ ।।

    ಅಶ್ವಥ್ಥ ಮೂಲೆ ಅಕ೯ ವಾರೆ ಸ್ಥಿತ್ವಾ ಪಠತಿ ಯ ಪುಮಾನ್
    ಅಚಲಂ ಶ್ರೀಯಮಾಪ್ನೋತಿ ಸಂಗ್ರಾಮೇ ವಿಜಯಂ ತದಾ ।। ೧೭ ।।

    ಲಿಖಿತ್ವಾ ಪೂಜಯೇತ್ ಯಸ್ತು ಸವ೯ತ್ರ ವಿಜಯೀ ಭವೇತ್
    ಯಾ ಕರೇ ಧಾರಯೇನ್ನಿತ್ಯಂ ಸಪುಮಾನ್ ಶಿ್ರೕಯಮಾಪ್ನುಯಾತ್ ।। ೧೮ ।।

    ಭುಧ್ಧಿ೯ಭಲಂ ಯಶೋ ಧೈರ್ಯಂ ನಿಭ೯ಯತ್ವಂ ಅರೋಗತಾ
    ಸುಧಾರಢ್ಯಂ ವಾಕ್ ಸ್ಪುಠತ್ವಂ ಚ ಹನೂಮದ್ ಸ್ಮರಣಾದ್ಭವೇತ್

    ಮಾರಣಂ ವೈರಿಣಂ ಸಾದ್ಯ ಶರಣಂ ಸವ೯ಸಂಪದಾಂ
    ಶೋಕಸ್ಯ ಹರಣೇ ದಕ್ಷಂ ವಂದೇ ತಂ ರಣ ದಾರುಣಂ

    ಸ್ಥಿತ್ವಾತು ಭಂದನೇನ ಯಸ್ತುಜಪಂ ಕರಯತಿ ದ್ವಿಜೈ
    ತಕ್ಷಣಾತ್ ಮುಕ್ತಿಮಾಪ್ನೊತಿ ಸತ್ಯಂ ಶ್ರೀರಾಮಭಾಷಿತಂ

    ಯ ಇದಂ ಪ್ರಾತರುತ್ಥಾಯ ಪಠೇತ್ ಕವಚಂ ಸದಾ
    ಆಯು್ಯರಾರೋಗ್ಯ ಸಂತಾನೈಸ್ತಥಾ ಸ್ತವ್ಯಸ್ತವೊ ಭವೇತ್

    ಇದಂ ಪೂರ್ವಂ ಪಠಿತ್ವಾತು ರಾಮಸ್ಯ ಕವಚಂ ತಥಾಃ
    ಪಠನೀಯಂ ನರೈ ಭಕ್ತ್ಯಾ ನೈಕಮೇವ ಪಠೇತ್ ಕಥಾ

    ಹನೂಮತ್ ಕವಚಂ ಚಾತ್ರ ಶಿ್ರೕರಾಮ ಕವಚಂ ವಿನಾ
    ಏ ಪದಂತಿ ನರ್ಚಾತ್ರಪದಾನಾಂ ತದ್ ವೃಥಾ ಭವೀತ್

    ತಸ್ಮಾದ್ ಸ್ಮರೈ ಪದನೀಯಮ್ ಸವಾ೯ದ್ ಕವಚ ದ್ವಯಂ
    ರಮಸ್ಯ ವಾಯುಪುತ್ರಾಯ ಶಭ್ದಕಥೈಶ್ಚ ವಿಷೇಶತಃ

    ಬ್ರಹ್ಮಾಂಡ ಪುರಾಣಾಂತರ್ ಗತೇ ನಾರದ ಅಗಸ್ತ್ಯ ಸಂವಾದೇ
    ಶ್ರೀರಾಮಚಂದ್ರ ಕಥಿತಂ ಪಂಚಮುಖೇಕ ಏಕ ಮುಖೀ ಹನುಮಾನ್ ಕವಚಂ
    ಓಂ ತತ್ ಸತ್ ನ


  320. Posted by Umesh on July 20, 2011 at 10:40 am

    Thanks a lot for Sharing.



  321. Posted by Puneeth on July 27, 2011 at 12:58 pm

    This is just so helpful. I’m very grateful for this collection.

    Thank you so much!


  322. Posted by Pramitha Lakshmi on August 1, 2011 at 12:30 am


    Can u please upload the lyrics of kankadhara stotram in malayalam.?



  323. Posted by K.Harini on August 1, 2011 at 2:05 pm

    Dear Madam,
    This is Harini and i stay in Mexico.Have u heard about “aidu sukravaara haadu”,”sravana sanivaarda haadu”..I have that book in kannada,but I want it in English.can u help me in any way?



  324. hi can please post mangala gowri pooja vidhana and story in detail


  325. Posted by Pramitha Lakshmi on August 4, 2011 at 12:02 am

    thanks a lot!!!


  326. Posted by LAKSHMI SUDHEER on August 5, 2011 at 1:01 am



  327. Posted by Rama on August 8, 2011 at 1:03 pm

    I am looking for an MP3 download for Vani Jayaram’s Dheera Gambhira Mangalam son from – Sri Durgabhavani Strotram CD. Can you please help me?


  328. Posted by Priya Nagarajan on August 10, 2011 at 3:16 am

    Can you please send the lyrics of govinda namo govinda namo narayana which is sung by Vidyabhushana and also of yeh savi yeh yeh savi hari nama sung by Sheshagiridasaru..


    • gOvindA namO. rAgA: Anandabhairavi. tripuTa tALA.

      P: gOvindA namO gOvindA namO gOvindA nArAyaNa
      gOvardhana giriyanettida gOvindA namma rakSisai
      C1: manca bAradu maDadi bAraLu kancu kannaDi bAradu
      sancitArthada dravya bAradu munce mADida dharmave
      2: arthavyArige putraryArige mitra bAndhavaryArige
      kartu yamanavareLedu oivAga artha putraru kAivare
      3: tandu bandare tanna puruSana hasidu baLalidirembaLu
      ondu divasavu tAradiddare handi nAyante keLevaLu
      4: prANa vallabhe tanna puruSana kANade nillalAraLu
      prANa hOgalu muTTalanjvaLu jANe karedaru bAraLu
      5: uNTu kAlake neNTariSTaru baNTarAgi kAivaru
      kaNTakemanOru bandu eLevAga neNTariSTaru bAraru
      6: oDeveyarasige oDalu agnige maDadi mattobba celuvage
      baDideLedu yamanavaru oivAga eDavi bidditu nAlige
      7: diTTatanadi puTTanALida vrSTinandana caraNava
      muTTi bhajisiro siri purandara viTTalEshana pAdava


  329. Posted by Rajesh.S on August 11, 2011 at 12:30 pm

    The site is fantastic.. Loved it.. n youngsters like me who luv to chant … this site seems to be very usefull


  330. Posted by Praveen on August 16, 2011 at 3:32 am

    Fantastic site thanks a lot , can you upload lyrics for Gopika Geetha (Jayathi JayathiKam) thank you -rgds


  331. Posted by Ashwini Kulkarni on August 22, 2011 at 6:05 pm

    Hi Mam,

    Thank you very much for building such a website.I got many songs lyrics correctly. I am feeling very happy today as i got so many songs lyrics in a single website. Its very useful one keep going. Good job & good site.

    I have a request, can u upload some other lord shiva, lord ganesha & goddess gowri songs. It will be a great help.




  332. Posted by kameshwararao on August 29, 2011 at 10:10 am

    need panchamukha anjenaya stotram in telugu


  333. Posted by kameshwararao on August 29, 2011 at 10:16 am

    need tulasi kavacham n medha dakshinamurthy stotram in telugu


  334. Posted by Veena Bheemesh on August 30, 2011 at 9:11 am

    Meera Madam,

    Can you load mangala gowri story in kannada please…


  335. Posted by Veena Bheemesh on August 30, 2011 at 9:12 am

    With regards,,


  336. Posted by amma on August 31, 2011 at 2:32 am

    This site has Dakhinamurthy stotras 2 or three different ones. Need Telugu font to read
    Here is the PDF from that site


  337. Posted by sudha acharya on August 31, 2011 at 7:25 am

    Meera madam,

    I wnat to know, you have the kannada lyrics of Sri Vadiraja Kavacha song – smarane madiro sode vadirajara. Please inform or send it.


  338. Posted by Nandini on September 6, 2011 at 6:52 am

    Hi Meera,

    I have learnt a great lot of things from your blogs. I am too a staunch devotee of rayaru. Recently when i went to mantralya, during the pooja they sung a song “smarisu gurugala manave”. Its a very nice song. can you please post the lyrics of this song if you can??? It will be a great help. Thanks My id:


  339. Posted by Harish on September 7, 2011 at 6:12 am

    I want Entha andha Entha chanda sharadamba lyrics in English, Please provide me. The song is sung br Dr. Rajkumar


  340. Posted by Sunitha on September 16, 2011 at 11:08 am

    Can u please let me know the lyrics of Kandu Kandu nee ena kai beduveya krishna…



  341. kaNDu kaNDu nIyenna. rAgA: mOhana. khaNDacApu tALA.

    P: kaNDu kaNDu nIyenna kaiya biDuvare puNDarIkAkSa puruSOttama harE
    C1: bandhugaLu enagilla badukinali sukhavilla nindeyali nondenai nIrajAkSa
    tande tAyiyu nInE bandhu baLagavu nInE endendigU ninna nambideno krSNa
    2: kSaNavondu yugavAgi trNakinta kaDeyAgi eNisalArada bhavadi nonde nAnu
    sanakAdi muni vandya vanaja sambhava janaka phaNishAyi prahlAdagolida shrI krSNa
    3: bhaktavatsalanemba biruda pottA mEle bhaktarAdhInanAgira bEDavE
    mukti dAyaka nInu honnUru puravAsa shakta guru purandara viTTala shrI krSNa


  342. Posted by Ranjana on September 18, 2011 at 8:34 pm


    We are looking for lyrics of ‘Hanumanta Hanumanta’ sung by Raichur Sheshgiridas.
    Could you please post one on your website or let us know where we can get the same?

    Thanking you for your help.


  343. Posted by sanchita on September 19, 2011 at 10:01 pm

    Plesae send me the meaning of tamil song “JAYA JAYA DEVI JAYA JAYA DEVI DURGA SARANAM ” by P suessela in englsh. Because I m bengali and I do not know tamil language.


  344. I have finding for the lyrics of Dasavathara sthuthi(protisha vighra) by vadirajaru from long if possible in English or sanskrit.Please help me as I searched all the websites and also leading bookshops at B’lore and chennai.


  345. The lines ar a little tricky to read since it uses the Harvard formatting system. I got this off the net:

    OM mathsyAya namaH:

    proshhThIsha vigraha sunishhThiiva noddhata vishishhTAMbuchAri jaladhe |
    koshhTha.ntarAhita vicheshhTAgamaugha parameshhThIDitattvamavamAm.h |
    preshhThArkasUnumanu jeshhThArthamAtmavidatIshhTo yugA.nta samaye |
    stheshhThAtma shR^iN^gadhR^ita kAshhThAmbuvAhana varAshhTA padaprabha tano ||1||
    OM sri HayagrIvaya namaH
    khaNDIbhavadbahuLaDinDIrajR^imbhaNa suchaNDI kR^ito dadhi mahA |
    kANDAti chitra gati shauNDAdya haimarada bhANDA prameya charita |
    chaNDAshvakaNThamada shuNDAla durhR^idaya gaNDA bhikhaNDAkara do |
    shchaNDA mareshahaya tuNDAkR^ite dR^ishama khaNDA malaM pradisha me ||2||
    OM kUrmAya namaH
    kUrmAkR^ite tvavatu narmAtma pR^ishhThadhR^ita bharmAtma ma.ndara gire |
    dharmAvalaMbana sudharmA sadAMkalita sharmA sudhAvitaraNAt.h |
    durmAna rAhumukha durmAyi dAnavasumarmA bhibhedana paTo |
    dharmArka kAnti vara varmA bhavAn.h bhuvana nirmANa dhUta vikR^itiH || 3||
    OM dha.nva.ntharE namaH
    dhanva.ntare.aN^garuchi dha.nva.ntareritaru dha.nva.nstarIbhavasudhA |
    bhAnva.ntarAvasatha manvantarAdhikR^ita tanva.ntaraushhadhanidhe |
    da.nva.ntaraN^gashubudanva.ntamAjishuvi tanvanmamAbdhi tanayA |
    sUnvantakAtmahR^idata.nvarAvayava tanva.ntarArtijaladhau || 4||
    OM srI nArAyaNayaI namaH
    yAxIravArdhimadanAxINadarpaditijAxobhitAmaragaNA |
    pexAptaye.ajanivalaxAMshhubiMbajidatIxNAlakAvR^itamukhI |
    sUxmAvalagnavasanAxepakR^itkucha kaTAxAxamIkR^itamano |
    dIxAsurAhR^itasudhAxANino.avatusu rUxexaNAddharitanuH || 5||
    OM srI narAyaNayaI namaH
    shixAdiyunnigama dIxAsulaxaNa parixAxamAvidhisatI |
    dAxAyaNI xamati sAxAdramApinaya dAxepavIxaNavidhau |
    prexAxilobhakaralAxAra soxita padAxepalaxitadharA |
    sAxiritAtmatanu bhUxArakAriniTilAxAxamAnavatu naH || 6||
    OM srI varAhAya namaH
    nIlAmbudAbhashubha shIlAdridehadhara khelAgR^itodhadhidhunI |
    shailAdiyukta nikhilelA kaTAdyasura tUlATavIdahana te |
    kolAkR^ite jaladhi kAlAchayAvayava nIlAbjadaMshhTra dhariNI |
    lIlAspadorutara mUlAshiyogivara jAlAbhivandita namaH || 7||
    OM srI narasI.mhAya namaH
    daMbholitIxNanakha saMbheditendraripu kuMbhIndra pAhi kR^ipayA |
    staMbhArbha kAsahanaDiMbhAya dattavara gaMbhIra nAda nR^ihare |
    aMbhodijAnusaraNAMbhojabhUpavana kuMbhIna sesha khagarAT.h |
    kuMbhIndra kR^ittidhara jambhAli shhaNmukha mukhAMbhoru hAbhi nuta mAm.h ||8||
    OM srI vAmanAya namaH
    piN^gAxa vikrama turaN^gAdi sainya chaturaN^gA valipta danuja |
    sAN^gA dhvarastha bali sAN^gAvapAta hR^ishhitAN^gA marAlinuta te |
    shR^iN^gAra pAdanakha tuN^gAgrabhinna kana kAN^gANDapatti taTinI |
    tuN^gAti maN^gala taraN^gA bhibhUta bhaja kAN^gAgha vAmana namaH || 9||
    ON srI vAmanAya namaH
    dhyAnArha vAmana tanonAtha pAhi yajamAnA sureshavasudhA |
    dAnAya yAchanika lInArtha vAgvashita nAnAsadasya danuja |
    mInAN^ka nirmala nishAnAtha koTila samAnAtma mauJNjiguNakau |
    pInAchchha sUtrapada yAnAta patrakara kAnamyadaNDavarabhR^it.h || 10||
    OM srI parashurAmAya namaH
    dhairyAmbudhe parashucharyAdhikR^ittakhala varyAvanIshvara mahA |
    shauryAbhibhUtakR^ita vIryAtmatajAbhuja vIryAvalepanikara |
    bhAryAparAdhakupitAryAGYayAgalitanAryAtma sUgala taro |
    kAryAparAdhamavichAryArya maughajayi vIryAmitA mayi dayA || 11||
    OM srI rAmAya namaH
    shrIrAmalaxmaNashukArAma bhUravatugaurAmalAmitamaho |
    hArAmarastuta yashorAmakAntisuta norAmanorathahara |
    svArAmavaryaripu vIrAmayArdhikara chIrAmalAvR^itakaTe |
    svArAma darshanajamArAmayAgatasughorAmanoramalabdhakalaha || 12||
    OM srI rAmAya namaH
    shrIkeshavapradishanAkesha jAtakapilokesha bhagnaravibhU |
    stoketarArtiharaNAkevalArtasukhadhIkekikAlajalada |
    sAketanAthavarapAkeramukhyasuta kokena bhaktimatulAm.h |
    rAkendu biMbamukha kAkexaNApaha hR^ishIkesha te.aN^ghrikamale || 13||
    OM srI rAmAya namaH
    rAmenR^INAM hR^idabhirAmenarAshikula bhImemanodyaramatAm.h |
    gomedinIjayitapomeyagAdhisuta kAmenivishhTa manasI |
    shyAme sadA tvayijitAmeya tApasaja rAme gatAdhikasame |
    bhImeshachApadalanAmeyashauryajita vAme xaNe vijayinI || 14||
    OM srI sItAsvarUpINaI shhrIyai namaH
    kAntAragehakhala kAntAraTadvadana kAntAlakAntakasharam.h |
    kAntArayAmbujani kAntAnvavAyavidhu kAntAshmabhAdipahare |
    kauntAliloladala kAntAbhishobhitila kAntAbhava.ntamanusA |
    kAntAnuyAnajita kAntAradurgakaTa kAntAramAtvavatu mAm.h || 15||
    OM srI rAmAya namaH
    dAntaM dashAnana sutA.ntaM dharAmadhivasa.ntaM prachaNDa tapasA |
    klA.ntaM sametya vipinA.ntaM tvavApa yamana.ntaM tapasvi paTalam.h |
    yAntaM bhavArati bhayAntaM mamAshu bhagava.ntaM bhareNa bhajatAt.h |
    svA.ntaM savAri danujA.ntaM dharAdharaNishAntaM sa tApasavaram.h || 16||
    OM srI rAmAya namaH
    shaMpAbhachApalava kaMpAsta shatrubala saMpAditAmitayashAm.h |
    shaM pAda tAmarasa saMpAti nola manu kaMpAra sena dishame |
    saMpAti paxi sahajaMpApa rAvaNa hataM pAvanaM yada kR^ithAH |
    tvAM pApa kUpa pati taM pAhi mAM tadapi paMpA sarasta Tachara || 17||
    OM srI rAmAya namaH
    lolAxyapexitasulIlAkuraN^gavada khelAkutUhala gate |
    svAlApabhUmijanibAlApahAryanuja pAlAdyabho jaya jaya |
    bAlAgnidagdhapura shAlAnilAtmajani phAlAttapattalarajo |
    nIlAN^gadAdikapi mAlAkR^itAlipatha mUlAbhyatIta jaladhe || 18||
    OM srI rAmAya namaH
    tUNIrakArmukakR^ipANIkiNAN^kabhuja pANI ravipratimabhAH |
    xoNibhapattinubha ghoNI mukhAdighanaveNIsuraxaNakaraH |
    shoNibhavannayana koNI jitAmbunidhi pANI ritArhaNamaNI |
    shreNIvR^itAN^ghririha vANIshasUnuvara vANIstuto vijayate || 19||
    OM srI rAmAya namaH
    huN^kArapUrvamataTaN^kAranAdamati paN^kAvadhArya chalitA |
    laN^kAshilochchayavishaN^kA padadbhidura shaN^kAshhayasya dhanushhaH |
    laN^kAdhipomanutayaN^kAlarAtrimiva shaN^kAshatAkuladhiyA |
    taN^kAladaNDashata saN^kAshakArmukha sharAN^kAnvitaM bhaja harim.h || 20||
    OM srI rAmAya namaH
    dhImAnameyatanujApANDabhUdhashashajapAMbujAti suhR^idAm.h |
    kAmAripannagapa kAmAhi vairiguru somAdivandya mahima |
    sthemAdinApagata sImAvatAtsakhala sAmAja rAvaNaripU |
    rAmAbhido harirabhaumAkR^itiH pratana sAmAdi vedavishhayaH || 21||
    OM srI rAmAya namaH
    doshhAtmabhUvashaturAshhADatikramaja doshhAtmabhartR^ivachasa |
    pAshhANabhUtamuniyoshhAvarAtmatanuveshAdidAyicharaNaH |
    naishhAdhayoshhidhasubheshhAkR^idaNDajani doshhAcharAdi suhR^ido |
    doshhAgrajanmamR^itishoshhApaho.avatu sudoshhAN^ghrijAtahananAt.h || 22||
    OM srI kR^ishnAya namaH
    vR^i.ndAvanasthapashu vR^i.ndAvanaM vinuta vR^i.ndArakaikasharaNam.h |
    na.ndAtmajaM nihata ni.ndA kR^idA surajanandAmabaddha jaTharam.h |
    vandAmahe vayama mandAvadAtaruchi mAndAxakArivadanam.h |
    kundAlidantamuda kandAsitaprabhatanu.ndAvarAxasaharam.h || 23||
    OM srI kR^ishnAya namaH
    gopAlakotsavakR^itApArabhaxarasa sUpAnnalopakupitA |
    shApAlayApitalayApAMbudAlisalilApAyadhAritagire |
    sApAN^gadarshanajatApAN^ga rAgayuta gopAN^ga nAMshuka hR^iti |
    vyApAra shauNDavividhApAya tatsvamava gopArijAtaharaNa || 24||
    OM srI kR^ishnAya namaH
    kaMsAdikAsadavataMsA vanIpativihiMsAkR^itAtmajanushham.h |
    saMsArabhUtamiha saMsArabaddhamana saMsArachitsukhatanum.h |
    saMsAdhaya.ntamanishaMsAttvikavratamahaMsAdaraM bata bhaje |
    haMsAditApasariraMsAspadaM paramahaMsAdi vandya charaNaM || 25||
    OM srI kR^ishnAya namaH
    rAjIva netravidurAjIvamAmavatu rAjIva ketanavasham.h |
    vAjIbhapattinR^ibharAjI rathAnvitaja rAjIva garvashamana |
    vAjIshavAhasita vAjIsha daitya tanu vAjIsha bhedakaradoH |
    jAjIkadaMbanava rAjIva mukhyasuma rAjIsuvAsitashiraH || 26||
    OM srI kR^ishnAya namaH
    kAlIhR^idAvasatha kAlIyakuNDalipa kAlIsthapAdanakhara |
    vyAlInavAMshukara vAligaNAruNita kAlIruche jaya jaya |
    kelIlavApahR^ita kAlishadattavara nAlIkatR^iptaditibhU |
    chUlIkagopamahilAlItanUghusR^iNadhUlIkaNAN^kahR^idaya || 27||
    OM srI kR^ishnAya namaH
    kR^ishhNAdi pANDusuta kR^ishhNA manaHprachura tR^ishhNA sutruptikaravAk.h |
    kR^ishhNAN^kapAlirata kR^ishhNAbhighAghahara kR^ishhNAdishhaNmahiLa bhoH |
    pushhNAtu mAmajita nishhNAda vArdhimuda nushhNAMshu maNDala hare |
    jishhNo girIndra dhara vishhNo vR^ishhAvaraja ghR^ishhNo bhavAnkaruNaya ||28||
    OM srI kR^ishNaya namaH
    rAmAshiromaNidharAmAsametabalarAmAnujAbhidharatim.h |
    vyomAsurA.ntakara te mAratAta dishame mAdhavAN^ghrikamale |
    kAmArtabhaumapura rAmAvalIpraNaya vAmAxipItatanubhA |
    bhImAhinAthamukhavaimAnikAbhinuta bhimAbhivandya charaNa || 29||
    OM srI kR^ishNAya namaH
    saxveLabhaxyabhaya dAxishravo gaNaja lAxepapAshayamanam.h |
    lAxAgR^ihajvalana raxo hiDimbabaka bhaixAnnapUrvavipadaH |
    axAnuba.ndhabhavarUxAxarashravaNa sAxAnmahishhyavamati |
    kaxAnuyAnamadhamaxmApasevanamabhIxNApahAsamasatAm.h || 30||
    chaxANa evanija paxAgrabhUdhashashhadAxAtmajAdi suhR^idAm.h |
    AxepakArikunR^ipAxauhiNIshajabalAxobhadIxitamanAH |
    tArxyAsichApasharatIxNAripUrvanija laxmANichApyagaNayan.h |
    vR^ixAlayadhvajariraxAkaro jayati laxmIpatiryadupatiH || 31||
    OM srI bhuddhAya namaH, OM srI kalkIne namaH
    buddhAvatArakavi baddhAnukaMpakuru baddhAJNjalau mayi dayAm.h |
    shauddhodanipramukha saiddhAntikA sugama bauddhAgamapraNayana |
    kruddhAhitAsuhR^itisiddhAsikheTadhara shuddhAshvayAnakamalA |
    shuddhAntamAMruchipi maddhAkhilAN^ga nija maddhAva kalkyabhidha bhoH || 32||
    OM srI badari nArAyana namaH
    sAraN^ga kR^ittidhara sAraN^ga vAridhara sAraN^ga rAjavaradA |
    sAraN^ga dAritara sAraN^ga tAtmamada sAraN^gataushhadhabalam.h |
    sAraN^ga vatkusuma sAraN^ga taJNchatava sAraN^ga mAN^ghriyugalam.h |
    sAraN^ga varNamapa sAraN^ga tAbjamada sAraN^ga diMstvamava mAm.h || 33||
    ma^nGAlA charana
    grIvAsya vAhatanu devANDajAdidasha bhAvAbhirAma charitam.h |
    bhAvAtibhavyashubha dIvAdirAjayati bhUvAgvilAsa nilayam.h |
    shrIvAgadhIshamukha devAbhinamya harisevArchaneshhu paThatAm.h |
    AvAsa evabhavitAvAgbhavetarasurAvAsalokanikare || 34||
    iti shrImadvAdirAjapUjyacharaNa virachitaM
    shrIdashAvatArastutiH saMpUrNam.h

    … bhAratIramaNamukhyaprANA.ntargata shrIkR^ishhNArpaNamastu


  346. Thankyou very much, I am extremely thankful to you. To be frank I started getting intrest in slokas and devotional songs after I went through this website.


  347. jaya janArdana krSNa rAdhikA patE
    jana vimOcana krSNa janma mOcana
    garuDa vAhana krSNa gOpikApatE
    nayana mOhana krSNa nIrajEkSaNa

    sujana bAndhava krSNa sundarakrtE
    madana kOmala krSNa mAdhava harE
    vasumati patE krSNa vasavanuja
    varaguNakara krSNa vaishNavakrtE
    suruciranana krSNa shauryavAridE
    murahara vibhO krSNa muktidAyaka
    vimalapAlaka krSNa vallabhipatE
    kamalalOcana krSNa kAmyadAyaka

    vimalagAtranE krSNa bhaktavatsalA
    caraNa pallavam krSNa karuna kOmalam
    kuvalaikSaNa krSNa kOmalAkrtE
    tava padAmbujam krSNa sharaNamAshrayE
    bhuvana nAyaka krSNa pAvanakrtE
    guNagaNojvala krSNa nalinalOcana
    praNayavAridhE krSNa guNagaNakara
    damasOdara krSNa dIna vatsalA

    kAmasundara krSNa pAhi sarvadA
    narakanAshana krSNa narasahAyaka
    dEvaki suta krSNa kAruNyambudE
    kAmsa nAshana krSNa dvAraksthita
    pavanAtmaka krSNa dEhi mangaLam
    tvatpadAmbujam krSNa shyama kOmalam
    bhaktavatsala krSNa kamyadAyaka
    pAlisennanu krSNa shrIhari namO

    bhaktadAsa nA krSNa harasu nI sadA
    kadu nintena krSNa salaheya vibhO
    garuDa vAhan krSNa gOpikapatE
    nayana mOhana krSNa nIrajEkSaNa


  348. Posted by Naveen Agastya on October 19, 2011 at 1:45 am

    🙂 Meera avarige nanna namaskaaragalu.
    no words to describe u as for the hard work u r doing for the people’s requirement..
    hruthpoorvaka vandane abhinandane galu nimage taayi..
    can u plz mail me the lyrics (kannada or english )of “Kamakshi Mangala Shasana”
    that is “Chakra rajasthithe chakra vaalanvithe vakra vaagvandite vikramanandite”
    I heartily dedicate this song to u 🙂


  349. Posted by Srilatha prakash on October 21, 2011 at 1:59 pm

    Hi meera can you please upload the song narayana ninna namada smarane.


  350. Posted by Leela on October 24, 2011 at 4:03 am

    Hi Please mail me the Nandhi kavasam in Tamil.

    My id is


  351. Om Sai Ram

    all members of this website please chant shata sloki ramayana / sankshepa ramayanam it is a very power full tool for all problems solver, excellent results good for health and wealth.



  352. shatashloi ramayana available excellent video please watch all members.
    Link is here


  353. Well done, I read it two times


  354. Posted by Praveen on November 2, 2011 at 10:22 am


    Can you please post lyrics in English for Namah Paarvathi pathi by Sri Vyasa theertharu


  355. Posted by sujatha on November 8, 2011 at 9:17 pm

    I am looking for JAGANNATHA DASARU’S LAKSHMI HRUDAYA, it is in kannada, it starts like “sri manohare lakumi thava pada”. I hear this sung by puttur narasimha nayak, it is very nice.



  356. Hi ,
    Am recently come to know about this site … its much appreciable that everyone can share slokhas, lyrics etc….

    here i found the lyrics of Vittala dasa’s one of the famous song…

    Baaro namma manege sri raghavendra baaro namma manege
    Baaro dhukkadipara baaro dhuritha dhoora baaraiya shanmarga dhari thoruva gurve (baaro )

    Vyasa nirmitha grantha madhwa kritha bhasyava besara dheyothi merava vyasa muniye(baaor)

    Manthra hredhali nintha suyathi varyane anthara thiliyatho nee anthara dholu (baaro)

    Bhootha pretha gala kyathisi bidu vantha kyathi udaryathi nathane stuthi suve (baaro)

    Khusta rogadhigala nastamaduvanta asta mahimayutha shresta muniye (baaro)

    Karadhare bharuvi yembo keeruthi kelina karethanu karunadhi karava pididhe yenthu (baaro )

    Bhakthavatsalanemba birudhi nindhadhara sathsanamore kele madhwesha vittala dasa (baaro)


  357. Hi ,
    Am recently come to know about this site … its much appreciable that everyone can share slokhas, lyrics etc….

    here i found the lyrics of Vittala dasa’s one of the famous song…

    Baaro namma manege sri raghavendra baaro namma manege
    Baaro dhukkadipara baaro dhuritha dhoora baaraiya shanmarga dhari thoruva gurve (baaro )

    Vyasa nirmitha grantha madhwa kritha bhasyava besara dheyothi merava vyasa muniye(baaor)

    Manthra hredhali nintha suyathi varyane anthara thiliyatho nee anthara dholu (baaro)

    Bhootha pretha gala kyathisi bidu vantha kyathi udaryathi nathane stuthi suve (baaro)

    Khusta rogadhigala nastamaduvanta asta mahimayutha shresta muniye (baaro)

    Karadhare bharuvi yembo keeruthi kelina karethanu karunadhi karava pididhe yenthu (baaro )

    Bhakthavatsalanemba birudhi nindhadhara sathsanamore kele madhwesha vittala dasa (baaro)


  358. hi chandrika

    please find the song which you requested long back sung by Dr.Rajkumar.

    Guruvaara banthamma guru vaara banthamma
    rayara nenayamma guru rayara neneyamma
    smarana marthradhali glesha kaledhu sathgathiya koduvanamma (guru)

    yogi baruva namma subha yoga baruvuthamma
    raghavendra guru raja bandhu bhava roga kalevanamma (guru)

    manava tholeyaramma bhakthiya maneye haaki ramma
    dyanadhindha karedhaki bandhu holegenna berevanamma (guru)

    kopa ariyanamma yaaranu dhoora thalla numma
    preethi mathike sothu baruva maguvanthe kaaniramma (guru)

    hindhe baruvanamma rayara nerelindha hanumaa
    hanuma nithade sri rama nithu nija mukthi koduvanamma ( guru)




  359. hi veena ,

    please find the lyrics of Kapadu sri sathya narayana..

    kaapadu sri sathyanarayana
    bannaga shayan baavana charana nambidhe ninna ( kaapadu )

    narayana lakshmi narayana
    narayana sathya narayana
    manavembo mantapa belagagidhe
    hari namadha manthrava thumbidhe
    ee maneyu neeniruva gudiyagli
    sukha shanthi nimmathiyu neleyagali ( kaapadu)

    nanagaki yenenthu naabeduve
    dhanakanaka bekenthu naakeluve
    yenthenthu sthiravaagi neeilligu
    nannalli onthagi usirahiru (kaapadu )

    panneera abisheka naamaduve
    karuneya nee yenna kaapaadithe
    karuthatha parikara naa maadithe
    naagaanandha nee needithe ( kaapadu )



  360. Hi

    Famous song by Purandara dasar sung by Puttlur narasimha nayak.

    Venunatha baaro

    Venunatha baaro venkata ramanane baaro
    baanana banghisi thantha bhavajayyane baaro (venunatha)

    Bhoothaniya moleyunda navaneetha chorane baaro
    bheetha raavanana samharisidha seetha nayaka baaro ( venunatha)

    billa murithu mallara ghetha pulla nabhane baaro
    kollathe rodana naliva cheluva mooruthi baaro (venunatha)

    mandhara giri yethhi thantha indire ramanane baaro
    kundhadhe govugala kaydha pundari kakshane baaro (venunatha)

    nariya ramnike poguva vaarija naabane baaro
    eerelu bhuvanava kayuva mara nayyane baaro (venunatha)

    sheshayana mooruthiyadha vasudhevane baaro
    dasarolu dasanadha purandhara vittala baaro (venunatha)




    • Posted by Praveen on November 17, 2011 at 9:28 am

      Thanks Charu ji,

      Do you by any chance have link to audio of the song so that we can listen. Appreciate your effort.


  361. Hi praveen ,

    which songs link you meant for ??


  362. Posted by Vanishree on November 18, 2011 at 7:02 am

    Hi Meera,

    Do you have lyrics of song “Ennantha Bhaktaru anantha ninagiharu ninnantha swamy yenagilla” written by Jagannatha Dasaru?


  363. Th eaudio is available here:

    If you figure out th lyrics please post them here. Thanks.


  364. Meera: I don’t know much kannaDa but I listened to the song and wrote down the lyrics. Plese correct any errors and repost the song lyrics. Thanks.

    ennantha bhaktaru. rAgA: mOhana. t/Adi tALA.

    P: ennantha bhaktaru ananta ninagiharu ninnantha svAmi enagillA
    ninnantha svAmi enagillA adarinda ninnitE ninna salahendu
    C1: patitana nAtharu patitana vAvana nIni ratratna janaka nagapANi
    ratiratna janaka nagapANi nI niralu itara cintyAtO enagiralu
    2: manadoLagE nI niddu manavendanu tIkoNDu manada vrttigaLenna krutisUvi
    manada vrttigaLenna krutisUvi sankarSaNanE ninnA karuNakkE enagANE
    3: nAnA padArthadoLu nAnA prakAradali nIniddu jagavA naDesUvi
    nIniddu jagavA naDesUvi hari nIne nAnembO nanagE gatiyuNTE
    4: ennappA annammA ennayyA ennaNNA ennarasA ennA kuladeiva
    ennarasA ennA kuladeiva ihaparadu ennA biTTagaladE irukaNDyE
    5: anAtha bandhu jagannAtha viThala sapanna paripAla mAlOlA
    sapanna paripAla mAlOlA harikAnca janyAdhrtapANi salahemmA


  365. Hi praveen ,

    The requested song in mp3 format. but here its not allowing me to update . if possible give me your mail id so that i can post the song on your mail.




  366. Posted by Praveen on November 20, 2011 at 3:54 pm

    Hi Charu Garu

    Here it is savemycentsATgmailDOTcom


  367. Posted by Vaishnavi Bharadwaj on November 21, 2011 at 3:11 am

    HI Meera,

    This is awesome effort input to educate pepl about the Dasaavaani.

    can you plz help me with the lyrics of
    “Yeshtu hellali venkatagiriya, drishtige bahu siriya” and
    “Ranga nayaka rajeeva lochane” songs.

    Plz plz…


    • ರಂಗ ನಾಯಕ ರಾಜೀವ ಲೋಚನ ರಮಣನೆ ಬೆಳಗಾಯಿತೇಳೆನುತ
      ಅ೦ಗನೆ ಲಕುಮಿ ತಾ ಪತಿಯನೆಬ್ಬಿಸಿದಳು ಶೃ೦ಗಾರದ ನಿದ್ದೆ ಸಾಕೆನುತ||

      ಸುರರು ಕಿನ್ನರರು ಕಿ೦ಪುರುಷರು ಉರುಗರು ಪರಿಪರಿಯಲಿ ನಿನ್ನ ಸ್ಮರಿಸುವರೋ
      ಅರುಣನು ಬ೦ದು ಉದಯಾ೦ಚಲದಲಿ ನಿ೦ದು ಕಿರಣ ತೋರುವನು ಭಾಸ್ಕರನು ಶ್ರೀ ಹರಿಗೆ||

      ಪಕ್ಷಿರಾಜನು ಬ೦ದು ಬಾಗಿಲೊಳಗೆ ನಿ೦ದು ಅಕ್ಷಿ ತೆರೆದು ಬೇಗ ವೀಕ್ಷಿಸೆ೦ದು
      ಪಕ್ಷಿಜಾತಿಗಳೆಲ್ಲ ಚಿಲಿಪಿಲಿಗುಟ್ಟುತ್ತ ಸೂಕ್ಷ್ಮದಲಿ ನಿನ್ನ ಸ್ಮರಿಸುವರೋ ಕೃಷ್ಣ ||

      ಪದುಮನಾಭನೆ ನಿನ್ನ ನಾಮಾಮೃತವನು ಪದುಮಾಕ್ಷಿಯರು ತಮ್ಮ ಗೃಹದೊಳಗೆ
      ಉದಯದೊಳೆದ್ದು ಸವಿದಾಡುತ್ತ ಪಾಡುತ್ತ ತದಿಯ ಕಡೆವರೆಳೋ ಮಧುಸೂಧನಾ ಕೃಷ್ಣ ||

      ಮುರಗಧರನೆ ನಿನ್ನ ನಾಮದ ಸ್ಮರಣೆಯ ಕರುಣಿಸಬೇಕೆ೦ದು ತರುಣಿಯರು
      ಪರಿ ಪರಿಯಿ೦ದಲಿ ಸ್ಮರಿಸಿಹರೈಪರು “ಪುರ೦ದರ ವಿಠಲ” ನೀ ಏಳೋ ಶ್ರೀ ಹರಿಯೇ||


      • Posted by Chitra on May 31, 2012 at 11:28 am

        ಕೃಷ್ಣನನ್ನು ಎಬ್ಬಿಸಲು ಸುಲಭವಾದ ಸುಂದರ ಕನ್ನಡ ಹಾಡನ್ನು ದಯಪಾಲಿಸಿದಕ್ಕೆ ನಿಮಗೆ ಅನಂತ ಅನಂತ ಧನ್ಯವಾದಗಳು .

      • ಸೋದರಿ, ನನ್ನವಳು ಇತ್ತೀಚೆಗಸ್ಟೇ ಈ ಹಾಡನ್ನು ಮನೆಯಲ್ಲಿ ಭಜನೆ ಮಾಡಿರುತ್ತಾಳೆ. ದಯಮಾಡಿ ಆಲಿಸಿ ನಿಮ್ಮ ಉಪಯುಕ್ತ ಸಲಹೆ ಸೂಚನೆಗಳನ್ನು ಕೊಡಬೇಕಾಗಿ ಕೋರಿಕೆ.

      • Posted by meeraghu on June 3, 2012 at 4:58 pm

        Awesome, very nice. Thanks so much for posting the audio and video here.

  368. ranganAraka rAjIvalOcana. rAgA: bhUpALa. cApu tALA.

    1: ranganAyaka rAjIva lOcana ramaNa tellavArE lEra
    sangaticE kaNTharasamu nA payyeda kongu tagilinadi lEra
    2: kommalu bangAru kuNDalO pannIru kosi vacciyunnAnu lEra
    sammtitO majjana mADarA nIku kamma kastUri diddEnu lEra
    3: gurulunnagaduvvi koNDayu jaTa vEsi virula sarula juTTe lEra
    tiramuga nI muddumOmuna gurutulu tIrcukondu gAni lEra
    4: kalakaNThulu tALagatula nATyamADi koluva vaccinAnu lEra
    kalakNTi munu gOpAkAntala gUDina kaluvarintalu mAni lEra
    5: tammikolakulanu tummeda panktulu kammu konunnavi lEra
    immaina I rEyi baDalikella dIra iravonda vasarenu lEra
    6: paruvaDi nIdivya uramunandu manci parimaLa maladeda lEra
    pariparui vidhamula pasiDi vINa mITi pADi meppinceda lEra
    7: puvvulacE ninnu pUjinci pogaDanu budhulu vaccinAnu lEra
    avva tercina roTTi AnavAlu venne Aragincu svAmi lEra
    8: angaranga vaibhOga rangayya aruNOdayamAye lEra
    pongali dadhyOdana mAragincanu puNya janAvana lEra
    9: kuluku gubbala munnu komarobbagummina gOpikalu vaccari lEra
    alarmEl manga vEnkaTapati dAsula Adarimpa vEga lEra
    10: lErA nAyayya lErA nA svAmi lErA tellavArE lEra
    lErA ubhaya kAvEri tIra vAsa shrI ranganAyaka lEra


    • Posted by Vaishnavi Bharadwaj on February 7, 2012 at 5:39 am

      Hi Lakshman,

      Appreciate your efforts. Thanks a lot.
      But actually this is not the song I am looking for.

      The initial lyrics of the song goes like ” Ranga Nayaka Rajeeva Lochane Ramanane belagaitu ell enutta”


      • ಸೋದರಿ, ನನ್ನವಳು ಇತ್ತೀಚೆಗಸ್ಟೇ ಈ ಹಾಡನ್ನು ಮನೆಯಲ್ಲಿ ಭಜನೆ ಮಾಡಿರುತ್ತಾಳೆ. ದಯಮಾಡಿ ಆಲಿಸಿ ನಿಮ್ಮ ಉಪಯುಕ್ತ ಸಲಹೆ ಸೂಚನೆಗಳನ್ನು ಕೊಡಬೇಕಾಗಿ ಕೋರಿಕೆ.

  369. Vaishnavi: Is there an audio clip available for this song?


    • Posted by Vaishnavi Bharadwaj on February 7, 2012 at 5:29 am

      Hello… Sorry for the delayed response.

      Sorry I really tried hard for it.. but couldnt find any.
      I have heared it at 1 of the Guruvara Bhajane in Raghavendra Swamy Mutt.


  370. Posted by Latha on November 24, 2011 at 5:04 am

    Hei madam iam Latha from bangalore i want the lyrics of all songs on Raghavendra Swamy, Hanuman and ayyappa songs sung by Dr. Rajkumar pls do the needful he has sung so many can u pls snd me all the lyrics


  371. Posted by Nalini on November 27, 2011 at 1:38 pm


    i really need the lyrics’ meaning of the Ramadasa keertana”OH Rama Nee NAMA ento ruchira….”
    thank u


  372. O rAma nI nAmamEmi. rAgA: yamunAkalyANi. Adi tALA.

    P: O rAma nI nAmamEmi rucirA shrI rAma nI nAmamenta rucirA
    A: enta rucirA rAma Emi rucirA rAma O rAmA nI nAmam enta rucirA
    C1: madhu rasamulakaNTE dadhi ghrtamulakanTE atirasamagu nAmamEmi rucirA
    2: navarasa paramAnna navanItamulakaNTE nadhikamau nI nAmamEmi rucirA
    3: drAkSA phalamu kanna nikSurasamu kanna pakSivAha nI nAma rucirA
    4: anjanA tanaya hrtkanja dalamunandu ranjillu nI nAmamEmi rucirA
    5: shrI sadAshivuDumadi sadA bhajincEDi sadAnanda nAma rucirA
    6: sAramu lEni samsAramunaku santArakamagu nAmamEmi rucirA
    7: sharaNanna janamula saraguna rakSincu birudu galgina nAmamEmi rucirA
    8: karirAja prahlAda dharaNIja vibhISaNula gAcina nI nAmamEmi rucirA
    9: kadalI kharjUra phala rasamula-kadhikamu patita pAvana nAmamEmi rucirA
    10: tumburu nAradulu Dambu mIraga gAnambu jEsEDi nAmamEmi rucirA
    11: panasa jambU drAkSA phalarasa sukhakaNTE nadhikamau nI nAma rucirA
    12: rAma bhadrAcaladAma rAmadAsuni prEma nElina nAmamEmi rucirA


  373. I would like to have the lyrics for the sloka sri hanumath ashtakam sung by p.b, srinivas , composed by madusudana srama sishyath virachitam.

    it starts with sri raghu raja padabhtinikethana pankaja lochana mangala dase……………..sri hanumath swapadam buja dashyam . audio format is availble in

    thank you so much


    • Hi there, I have posted Srimad Hanumadashtakam in few different language scripts on my blog, I hope you will find it helpful, the link to the site is


    • Sri Raghu raja padabja niketana pankajalochana mangla rashe
      Chanda maha bhuja danda surathibhi khandana panditha pahi dayalo
      Pathathinam jasamudhtharamam mahathaamhisathamabhimanamudharam
      Swambhajatho mama dehithadhyakhana he hanumaswapadambhuja dasyam

      Samsrithi thapa mahalanaladatha thanuruha marmathanorathibeeham
      Puthra dhanswajanathma gruhathishu sakthamathee rathikhilmishamurthee
      Hena chithabhyama lena purakrutha punya supunchala vena vibhoovayu
      Swambhajatho mama dehithadhyakhana he hanumaswapadambhuja dasyam

      Samsrithi koopamanalpamaghani nidagha nindanamajshramashehsam
      Prapya sudukha sahshra bhujanga vishykha samakhula sarvathanoormyee
      Khora mahathrupana pada meva gadasya hare pathi thasya bhava bhau
      Swambhajatho mama dehithadhyakhana he hanumaswapadambhuja dasyam

      Samsrithi sindhu vishaala karaala mahabala kaala chashagra sanartham
      Yagra samgradhiyanthru panamcha mahamadanakra suchakra hirdaasum
      Kaala maha rasanorminipeeditha mudhara deenamananyaka thinma
      Swambhajatho mama dehithadhyakhana he hanumaswapadambhuja dasyam

      Samsrithi khora maha gahalechara thoma niranjitha punya sumurthe
      Manmatha bheegara khora mahoogra mrugapravarathitha gathra susandhye
      Mathsara thapa visheshanipeeditha bahyamatheschaka damchithameeyam
      Swambhajatho mama dehithadhyakhana he hanumaswapadambhuja dasyam

      Samsrithi vrukshamanegha shathagha nidanamanatha vikarma sushagham
      Dukhabhalam karanadi palashamananga supushpama chinthyasumoolam
      Ramyadhiruhya hareepathitham sharanagathameva vimoochayamoodam
      Swambhajatho mama dehithadhyakhana he hanumaswapadambhuja dasyam

      Samsrithi pannaga vakthra bhayangara damshtra maha visha daghtha shareeram
      Prana vinirgama bheethi samakula nandamanadhamatheeva vishannam
      Moha mahakuhareepathitham dayayotharamamajitheenthiriya kaamam
      Swambhajatho mama dehithadhyakhana he hanumaswapadambhuja dasyam

      Inthriya namaka chaura ganairhritha thathva viveeka mahadhanaraashim
      Samsrithi jalalipathithameva mahabali vischa vigandhitha kayam
      Vathpada pathmamanuthamamashritha mashukapeeshwara parikripaloo
      Swambhajatho mama dehithadhyakhana he hanumaswapadambhuja dasyam

      Brahmamarugana rudhramaheendra kireeda sukoodila sathpadapeedam
      Dasharadinthyathikshithi mandala yeshanidaya sadaiva hridathyee
      Thasya hanumatheyava shivakaram ashtakameeda danishta haramvayyu
      Yassa thatham hi padeth sanaroolapatheekshutha ramapadabhya nivasam

      Ithi sri madusoodanamshrama shishychutha virachitham
      srimadhanumathashtakam sampoornam


  374. Hi praveen ji ,

    hope u have received my mail … here i have found the link for the song “venunaatha baaro”..
    please find the below link




  375. Hi friends ,

    Any one of u please send me the audio track for the song “Angala dola ramanaaditha””.




  376. Dear any one,

    I want the stotram lyrics for P.b. srinivas sri Hanumath ashtakam. can anyone reply with the lyrics?

    it starts with sri raghu raja padam budinikethana pankaja lochana mangala daye

    thank you,



  377. I managed to transcribe three stanzas of the aSTakam. Corrections welcome:

    1: shrI raghurAja padAbja nikEtana pankaja lOcana mangaLa rAjE
    khaNDa mahAbhuja daNDa suradidhi khaNDana paNDita pAhi dayALO
    pAtakinca samumuddAramAm mahatangitatam ati mAnam udAram
    tvAm bhajatO mama dEhi dayAdhana hE hanumantva padAmbujadAtyam
    2: samskrti tApa mahAnala takkasarUruha manmathanOrmatidEram
    putra tansava janat-madhuhAdishuttamadE rati kilbishamUrtE
    tEna cirabhayam adEnapurakrta puNya sukunjala dEnadisOvai
    tvAm bhajatO mama dEhi dayAdhana hE hanumantva padAmbujadAtyam
    3: samskrti dhUjam analpama ghAninadhadha nidhAnamajastra sESam
    prAkhya sudukhkhata hastra bhujanga visharkata matula sarvatanurti
    ghOra mahA krpANa padamEva gatarsya harE harE pati tasya bhavAbdau
    tvAm bhajatO mama dEhi dayAdhana hE hanumantva padAmbujadAtyam

    I m


    • I Found this while i was frantically searching for hanumadashtakam…hope this helps a few here.

      shrI raghurAja-padAbjaniketana pa.nkajalochana ma.ngalarAshe,
      chaNDa-mahAbhuja-daNDa-surArivi-khaNDanapaNDita pAhi dayAlo |
      pAtakinaM cha -samuddhara mAM- mahatAM hi satAmapi mAnamudAraM,
      tvAM bhajato mama dehi dayAghana he hanumatsvapadAmbujadAsyam || 1||

      putradhanasvajanAtmagR^ihAdiShu sak{}tamateratikilbiShamUrteH |
      kenachidapyamalena purAkR^itapuNyasupu.njalavena vibho vai, tvAM
      bhajato… || 2||

      prApya suduHkhasahasrabhuja.ngaviShaikasamAkulasarvatanorme |
      ghoramahAkR^ipaNApadameva gatasya hare patitasya bhavAbdhau, tvAM
      bhajato… || 3||

      vyagrasamagradhiyaM kR^ipaNaM cha mahAmadanakrasuchakrahR^itAsum |
      kAlamahArasanorminipIDitamuddhara dInamananyagatiM mAM, tvAM
      bhajato… || 4||

      sa.nsR^itighoramahAgahane charato maNira.njitapuNyasumUrteH,
      manmathabhIkaraghoramahogramR^igapravarArditagAtrasusandheH |
      matsaratApavisheShanipIDitabAhyamateshcha katha.nchidameyaM, tvAM
      bhajato… || 5||

      duHkhaphalaM karaNAdipalAshamana.ngasupuShpamachintyasumUlam |
      taM hyadhirUhya hare patitaM sharaNAgatameva vimochaya mUDhaM, tvAM
      bhajato… || 6||

      prANavinirgamabhItisamAkulamandhamanAthamatIva viShaNNam |
      mohamahAkuhare patitaM dayayoddhara mAmajitendriyakAmaM, tvAM
      bhajato… || 7||

      sa.nsR^itijAlanipAtitameva mahAbalibhishcha vikha.nDitakAyam |
      tvatpadapadmanuttamamAshritamAshu kapIshvara pAhi kR^ipAlo, tvAM
      bhajato… || 8||

      brahmamarUdgaNarUdramahendrakirITasukoTilasatpada pIThaM
      dAsharathiM jayati kShitimaNDala eSha nidhAya sadaiva hR^idabje |
      tasyahanUmata eva shiva.nkaramaShTakametadaniShTaharaM vai,
      yaH satataM hi paThetsa naro labhate.achyutarAmapadAbjanivAsam || 9||

      || shrImadhusUdanAshramashiShyAchyutavirachitaM shrImaddhanumadaShTakaM
      saMpUrNam ||


  378. Thank you so much for the Hanumath ashtakam. can I have the rest of the slokam?

    thank you so much for your help.



  379. Posted by Mahadeva on December 8, 2011 at 9:43 pm

    Nanage tumba tumba santosha aagta ide nimma e-web sikkiddu.. Thank u thank u very much for your marvaless collection,


  380. Posted by Mahadeva on December 8, 2011 at 9:45 pm

    Nanage tumba tumba santosha aagta ide nimma e-web sikkiddu.. Thank u thank u very much for your marvaless collection, ಧನ್ಯವಾದಗಳು


  381. Posted by Mahadeva on December 8, 2011 at 9:48 pm



  382. Posted by Mahadeva on December 9, 2011 at 3:28 am

    Hi meera do you have ayyappa swamy astottara?


  383. Posted by Shiva Narayan on December 14, 2011 at 2:23 am

    Hi Meera

    I was earlier able to found lyrics for preenayamo .. Now its no longer there.. says page lost.
    Could you please reload that lyrics. I love that song very much

    Btw you do a great job maintaining this website. really helpful 🙂



  384. Posted by swathi on December 27, 2011 at 5:10 am

    hello its really a vry nice blog …. appreciations to ur efforts.. well can u pls upload the lyrics for INTHU POGALENNAMA SrIKAANTHANA PAADA..thnx in adv..


  385. Posted by Nandini on December 29, 2011 at 5:17 am

    do u have the lyircs of mangalam shubh mangalam ityam shubh mangalam


  386. Posted by Gopal on December 31, 2011 at 1:38 am

    hello Meera Madam,
    its really a vry nice blog …and very usefull too
    well can u pls upload lyrics of song “Yesthu Helali Venkata Giriya, drusthi ge bahu siriya “.


  387. I am new to this site.
    I need a song about hanumantha Nice one To sing for madhwa jaayanthi
    Any one can help Me?
    Happy new year to all.


  388. Posted by Janardhan R. Hungund on January 5, 2012 at 7:05 am

    Hi Meera Madam,
    This is an amazing collection of lyrics which is very rare to find even in the whole internet world. I really appreciate this effort to note down the lyrics. I accidentally found your site while searching for the lyrics of Kannada devotional song. I was so disappointed as I could not find any site in my first attempt. I had almost made-up my mind to create a blog/web-site similar to yours. But, I am relieved that there are people like you who are working so hard to put together the lyrics of Kannada songs. I will not give up my resolution. I will try to provide you the lyrics of many other songs not listed here treating it as an “alilu seva” for the big task that you are doing.

    Hats off for this effort.



    • Posted by meeraghu on January 5, 2012 at 8:42 am

      Hi Janardhan Sir,
      Appreciate your comment. Yes, please do provide me any lyrics you have. I will post it in the blog.


  389. Posted by Narayan Kulkarni on January 5, 2012 at 11:46 am

    hats off to you……can we have a lyrics of Hanumantha hanumantha……..and one more song tangigehelida krishna…..and one more pls hosa kannu yenage needalibeku jagadamba……


    • Posted by Lakshman on February 19, 2012 at 2:07 am

      tangig-hELida. rAgA: kAmbhOji. jhampe tALA. Composer: Purandaradasa.

      P: tangig-hELida krSNa candadali buddhi
      A: atteya maneyalli iruvantha suddi
      C1: yArEnu andaru mOreyanu tiruhadiru mOre mEle kaiyetti ballaLendeNisi
      vArgEvara kUDi nIrannu taruvAga vAre kaNNisi nODa nODadiru kaNDya
      2: parara oDaveya kaNDu duruLa mAtADadiru nerehoreyarige nInu talevAgi naDeya
      parara mAtugaLinda duruLendu enisa bEDa nerehoreyara kaNDu nI baduku mADamma
      3: bhangArada pETeyoLu angaDige hOgadiru anganErige mAna bhangAgi maDeya
      anganErige ninnantarangava hELadiru bhangAra vastugaLu mucci koLLamma
      4: hAgiddu nInuNDu bEkendu bEDadiru sAku sAku emba nAcikeya hiDiye
      nAkumandiyaroDane kOke mAtADadiru lOkadoLivaLobba mUgiyendenise
      5: iSTaru andaru niSTUravADadiru ghaTTi mADamma ninna manasu
      shrSTiyoLage namma purandara viTalanna shrESTanAda krSNanna tangiyendenisise


  390. Posted by Praveen Biligiri on January 8, 2012 at 1:09 am

    can I have lyrics of “Dimbadalliruva Jeeva…” please?


  391. Posted by Veena Bheemesh on January 14, 2012 at 11:42 am

    Can you please publish the famous aarthi song Srinatha Govinda anandha mooruthige…….


  392. Posted by Poornima Nayak on January 20, 2012 at 1:17 pm

    Dear Meera Mam,

    i am a pgdhrm from india and in very trouble to give good health to my baby. Please guide me to US so that I can start my life on my own and give good health to my baby. My husband doesnt support me and in very tragic situation. I will be very grateful to you if you help me in getting any job in US for a small start of my life.
    My email is
    waiting for your reply,


  393. Posted by Divya on January 21, 2012 at 9:38 am

    I am searching for “Hanumantha Deva Namo” in Poorvikalyani by Purandaradasa. Can you kindly post the lyrics if you have it. Thanks. This is a great website.



    • Posted by Lakshman on February 19, 2012 at 2:16 am

      hanumanta dEva . rAgA: bhUpALi. Eka tALA.

      P: hanumanta dEva namO
      A: vanadhiyanu dATi dAnavara daNDisida
      C1: anjaneya garbha puNyOdayanendenipe kanja sakha maNDalake kai tuDukide
      bhunji sIrELu jagangaLanu uLuhide bhanjanAtmaja guruve sari kANe ninage
      2: hEmakuNDala hEma yajnOpavItakhiLa hEma kaTi sUtra kaupInadaHri
      rOma kOTi linga sarva shyAmala varNa rAma bhrtyane ninage sari kANe guruve
      3: akSaya kumArakana niTTorasi pisuTu nI rAkSasAdhipa rAvaNanu raNadali
      vakSa sthaLadalli shikSisalu mUrceya bakeya rakSisite rakSisite rAya balavanta
      4: rAma lakSmaNara kaNDALAgi nI merade bhUmijege mudreyunguravanitte
      A mahA lankA nagara vellavanu suTTu dhUmadhAmava mADi aLideyA mahAtma
      5: shrImadAcAryara purapatiyendenipa shrI mahAlakumi nArAyaNa rUpa
      shrI manOhara purandara viTTala rAyana saumya manadALu hanumanta balavanta


  394. Posted by Gowri Venk Narasimhan on February 2, 2012 at 12:17 am


    I am searching for Sri Raghavendra suprabadham can you kindly post the lyrics if you have it. Thanks.

    Mrs. Gowri Venkat Narasimhan


  395. can you send me “sumukashcha ekdanta” sloka
    regards shekar


  396. Posted by Parimala on February 23, 2012 at 11:22 pm

    Hi Meera,

    Please can you provide the lyrics for Sri Madramapadaravinda
    Madhupaha (Raghavendra Mangalaskatam) if you have.

    I appreciate your effort in putting up all the Madhwa rituals and the devotional songs with lyrics.



  397. Appreciate it if someone can give a running meaning for the song on hanumAn. Thanks in advance.
    rAga : hindusthAni kApi/pUrvikalyANi tALam: ATa/Adi
    p. sAri bandane prANESha bandane
    a. sAri bandalangkApurava mIrida rAvaNana kaNDu dIranu vayyAradinda
    c1. vAyu putrane ShrI rAmana dUtane
    prIyadinda sItAnganege
    mudrikeya tandittavane
    c2. bhImasEnane kuntI tanayane
    virATaNa maneyali nintu
    kIcakana samharisidane
    c3. madhvarAyane sarvajna ShrEshTane
    advaitava geddu
    purandara viThalana munde nintane


  398. where can i lister to this song recited words are very good, I understand the mening but not sure enough to translate. shyamala.


  399. Posted by nagarajan.g on March 12, 2012 at 6:23 am

    a great site iam happy to see this


  400. Posted by Radhika on March 14, 2012 at 9:53 am

    thanks for lyrics


  401. Posted by Chitra on March 28, 2012 at 3:07 pm

    Found a very great site. Thanks to one and all


  402. Posted by kiran kumar on April 10, 2012 at 3:30 am

    sir, i want lali govinda lali lyrics please………………………..!


  403. lAli gOvinda lAli. rAgA: Anandabhairavi. jhampe tALA. Shripadaraya.

    P: lAli gOvinda lAli kausalyA bAla shrIrAma lAli
    A: lAli munivandya lAli jAnakI ramaNa shrIrAma lAli
    C1: kanakaratnagaLalli kAlgaLane hUDi nAlku vEdagaLannu sarapaNiya mADi
    anEka bhUmaNDalava halageya mADi shrIkAntanuyyAleyanu viracisidaru
    2: AshcaryajanakavAgi nirmisida pacceya toTTilalli
    acyutAnantaniralu tUgidaru matsyAvatAra hariya
    3: dharmasthApakanu endu niravadhika nirmala caritranendu
    marma karmagaLa pADi tUgidaru kUrmAvatAra hariya
    4: sarasijAkSiyarellaru janavashI kara divya rUpanendu
    parama haruSadali pADi tUgidaru varAhAvatAra hariya
    5: kari kumbhagaLa pOluva kucadalli hAra padakavu hoLeyalu
    varavarNiniyaru pADi tUgidaru narasimhAvatAra hariya
    6: bhAmAmaNiyarellaru yaduvamsha sOmanivanendu pogaLi
    nEmadindali pADi tUgidaru vAmanAvatAra hariya
    7: sAmajavaradanendu atuLa bhrugu rAmAvatAranendu
    shrImadAnanda hariya tUgidaru prEmAtirEkadinda
    8: kAmanige kAmanendu surasArva bhauma guNadhAmanendu
    vAmanEtreyaru pADi tUgidaru rAmAvatAra hariya
    9: sruSTiya kartanendu jagadoLage shiSTa santuSTanendu
    druSTAntarahitanendu tUgidaru kruSNAvatAra hariya
    10: vruddha nAriyarellaru jagadoLage prasiddha nivanendu pogaLi
    baddhAnurAgadinda tUgidaru bauddhAvatAra hariya
    11: ThaLaThaLatkAradinda ranjisuva malayajalEpadinda
    jalajagandhiyaru pADi tUgidaru kalkyAvatAra hariya
    12: kanakamaya khacitavAda talpadali vanajabhava janakaniralu
    vanajanAbhanna pADi tUgidaru vanitAmaNiyarellaru
    13: padmarAgava pOluva haripAda padmavanu tamma hrudaya
    padmadali nillisi pADi tUgidaru padminI bhAminiyaru
    14: hastabhUSaNa mereyalu divyatara hastalAghavagaLinda
    hastagaLa piDidukonDu tUgidaru hastinI bhAminiyaru
    15: mattagajagAminiyaru divyatara citra vastragaLanuTTu
    citta santOSadinda tUgidaru cittinI bhAminiyaru
    16: kankaNa dhvanigaLinda ranjisuva kinkiNI svaragaLinda
    pankajAkSiyaru pADi tUgidaru shankinI bhAminiyaru
    17: cokka kastUri pankadim ranjisuva makarikA patra baredu
    likucastaniyaru pADi tUgidaru akaLanka carita hariya
    18: pallavAdhareyarella I shishuvu tulyavarjitavenutali
    sallalitagAnadinda tUgidaru kalyANi rAgadinda
    19: Ananda sadanadoLage gOpiyaru A nandasutana kaNDu
    AnandabharitarAgi tUgidaru Anandabhairaviyinda
    20: dEvAdidEvanendu I shishuva bhAvanAtItanendu
    dEvagandharvaru pADi tUgidaru dEvagAndhAradinda
    21: nIla ghanalIla jO jO karuNAlavAla shrIkruSNa jO jO
    lIlAvatAra jO jO paramAtma bAlagOpAla jO jO
    22: indudharamitra jO jO shIkruSNa indu ravi nEtra jO jO
    inDu kulaputra jO jO paramAtma indirAramaNa jO jO
    23: tunga bhavabhanga jO jO paramAtma ranga krupAnga jO jO
    mangaLApAnga jO jO mOhanAnga rangaviThalane jO jO


  404. Posted by S. Sankara Narayanan on April 12, 2012 at 6:53 am

    Can any one give me the lyrics of the following Kannada devotional songs.

    1.Indu Sukravara 2. Kandena Govindana 3. Rama mantrava japiso 4. adi lakshmi devige aarathiya yetire

    Thanks in advance.


  405. rAma mantrava japisO. rAgA: madhyamAvati. Adi tALA. Purandaradasa.

    P: rAma mantrava japiso hE manujA
    A: A mantra I mantra necci nI keDabEDa sOmashEkhara tanna bhAmini gorediha
    C1: kula hInanAdarau kUgi japisuva mantra sale bIdiyoLu uccaripa mantra
    halavu pApangaLa hadageDisuva mantra sulabhadindali svarga sUre kombuva mantra
    2: marutAtmaja nitya smaraNe mADuva mantra sarvarSigaLalli sErida mantra
    durita kAnanakidu dAvAnala mantra poredu vibhISaNage paTTa kaTTida mantra
    3: snAna maunangaLige sAdhanada mantra mAnvaru manadi dhyAnipa mantra
    hIna guNangaLa hisukutiha mantra Enembe vibhISaNage sAravinibha mantra
    4: sakala vEdagaLige sAravenipa mantra mukuti mArgake idE mUla mantra
    bhakuti rasake ommebaTTe tOruva mantra sukhanidhi purandara viTTalana mahA mantra
    5: jnAnanidhi namma Ananda tIrttaru sAnurAgadi nitya sEvipa mantra
    bhAnu kulAmbudhi sOmanenipa namma dInarakSaka purandara viTTalana mantra

    kaNDenA gOvindana. rAgA: kAmavardhani / varam. Adi tALA. Purandaradasa.

    P: kaNDenA gOvindana puNDarIkAkSa pANDava pakSa krSNana
    C1: kEshava nArAyaNa shrI krSNana vAsudEva acyutAnandana
    sAsira nAmada shrI hrSIkEshana shESashayana namma vasudEva sutana
    2: mAdhava madhusUdana trivikramana yAdava kula vandyana
    vEdAnta vEdyana indirA ramaNana Adi mUruti prahlAda varadana
    3: puruSOttama narahari shrI krSNana sharaNAgata rakSakana
    karuNAkara namma purandara viTTalana nere nambidenu bElUra cennigana


  406. Posted by Chitra on April 15, 2012 at 12:42 pm

    Here are the lyrics for ಕಂಡೆನಾ ಗೋವಿಂದನ

    ಕಂಡೆನಾ ಗೋವಿಂದನ
    ಪುಂಡರೀಕಾಕ್ಷಪಾಂಡವ ಪಕ್ಷ ಕೃಷ್ಣನ

    ಕೇಶವ ನಾರಾಯಣ ಶ್ರೀ ಕೃಷ್ಣನ
    ವಾಸುದೇವ ಅಚ್ಯುತಾನಂತನ
    ಸಾಸಿರ ನಾಮದ ಶ್ರೀ ಹೃಷಿಕೇಶನ
    ಶೇಷ ಶಯನ ನಮ್ಮ ವಸುದೇವ ಸುತನ

    ಮಾಧವ ಮಧುಸೂದನ ತ್ರಿವಿಕ್ರಮನ
    ಯಾದವ ಕುಲ ವ೦ದ್ಯನ
    ವೇದಾಂತ ವೇದ್ಯನ ಇಂದಿರಾ ರಮಣನ
    ಆದಿ ಮೂರುತಿ ಪ್ರಹ್ಲಾದವರದನ

    ಪುರುಷೋತ್ತಮ ನರಹರಿ ಶ್ರೀ ಕೃಷ್ಣನ
    ಶರಣಾಗತ ಜನ ರಕ್ಷಕನ
    ಕರುಣಾಕರ ನಮ್ಮ ಪುರಂದರವಿಠಲನ
    ನೆರೆ ನ೦ಬಿದೆನು ಬೇಲೂರ ಚೆನ್ನಿಗನ


  407. Posted by Chitra on April 15, 2012 at 1:12 pm

    Here are the lyrics for ರಾಮ ಮಂತ್ರವ ಜಪಿಸೋ

    ರಾಮ ಮಂತ್ರವ ಜಪಿಸೋ ಹೇ ಮನುಜ
    ರಾಮ ಮಂತ್ರವ ಜಪಿಸೋ
    ಆ ಮಂತ್ರ ಈ ಮಂತ್ರ ಜಪಿಸಿ ಕೆಡಲು ಬೇಡ
    ಸೋಮಶೇಖರ ತನ್ನ ಭಾಮೆಗ್ಹೆಳಿದ ಮಂತ್ರ

    ಕುಲಹೀನನಾದರು ಕೂಗಿ ಜಪಿಸೋ ಮಂತ್ರ
    ಸಲೆಬೀದಿಯೊಳು ಉಚ್ಚರಿಸುವ ಮಂತ್ರ
    ಹಲವು ಪಾಪಂಗಳ ಹದಗೆಡಿಸುವ ಮಂತ್ರ
    ಸುಲಭದಿಂದಲಿ ಮೋಕ್ಷ ಸೂರೆಗೊoಬುವ ಮಂತ್ರ

    ಮರುತಾತ್ಮಜ ನಿತ್ಯ ಸ್ಮರಣೆ ಮಾಡುವ ಮಂತ್ರ
    ಸರ್ವ ರಿಶಿಗಳಲಿ ಸೇರಿದ ಮಂತ್ರ
    ದುರಿತ ಕಾನನಕಿದು ದಾವಾನಲ ಮಂತ್ರ
    ಪೊರೆದು ವಿಭೀಷಣಗೆ ಪಟ್ಟಗಟ್ಟಿದ ಮಂತ್ರ

    ಜ್ಞಾನನಿಧಿ ನಮ್ಮ ಆನ೦ದ ತೀರ್ಥರು
    ಸಾನುರಾಗದಿ ನಿತ್ಯ ಸೇವಿಪ ಮಂತ್ರ
    ಭಾನು ಕುಲಾ೦ಬುಧಿ ಸೋಮನೆನಿಪ ನಮ್ಮ
    ದೀನ ರಕ್ಷಕ ಪುರಂದರವಿಠಲನ ಮಂತ್ರ


  408. Posted by shubha rao on April 19, 2012 at 2:54 pm

    Hi Meeraji,

    Krishna na aaruthi songs yavdaadru post maadakke aagatta?
    And ii erd songs du lyrics gottidre post maadi.
    1) aaruthi belagire ma ramanage vara nariyaru paramaadaradi….
    2) belaguvenaaruthiya naanu balakrishna ge….



    • Posted by Shubha on January 29, 2013 at 7:41 pm

      Hi Meeraji,

      I got this lyrics from my mom but she has forgotten the last paragraph.

      ಆರುತಿ ಬೆಳಗಿರೆ ಮಾ ರಮಣಗೆ ವರ ನಾರಿಯರು ಪರಮಾದರದಿ
      ಸಾರುತ ಹರಿಗುಣ ಬೀರುತ ಮುದದಲಿ ಸರಸಿಜ ನಯನಗೆ ಹರುಷದಲಿ

      ನಿಗಮ ಕಾಯ್ದು ತಾ ನಗ ಬೆನ್ನಲಿ ಪೊದ್ದು ಅಗಿದು ಬೇರು ಮೆತ್ತ ವರಹನಿಗೆ
      ಮಗುವಿನ ಗೋ ಸುಗ ನಗುತ ಕಂಬದಿ ಬಂದ ಜಗದೊಡೆಯಗೆ ಬೇಗ ಸುಗುಣೆಯರು

      ಸುಂದರ ವಾಮನ ನಿಂದು ಭಾರ್ಗವಗೆ ರಂಭೆ ಅಹಲ್ಯೋಧಾರಕೆಗೆ
      ಸುಂದರ ಗೋಪಿ ವೃಂದದ ಕುಣಿಯುವ ನಂದನಿಗೆ ಗೋಪಿ ಕಂದನಿಗೆ

      Will upload the rest as soon as I get it. 🙂



  409. Is this one of the songs?

    Aratiya beLagire. rAgA: shrI. aTa tALA. Purandaradasa.

    P: Aratiya beLagire
    C1: arasi rukmiNi kUDa arasu viTTalage birudina shankhava piDida viTTalage
    sarasija sambhava sannuta viTTalage niruta iTTige mEle ninta viTTalage
    2: dasharatharAyana udaradi viTTala shishuvAgi janisida shrI rAma viTTala
    pashupati gOpiya kandane viTTala asure pUtaniya konda viTTalage
    3: kaNDira bobbura venkaTavittalana aNDaja vAhana ahudO nI vittala
    pANduranga kSEtra pAvana viTTalA puNDarIkAkSa shrI purandara viTTalage


  410. Posted by Chitra on April 20, 2012 at 9:00 pm

    There is one more aarti song

    ಆರತಿಯನು ಬೆಳಗಿರೆ ಶ್ರೀದೇವಿಸಹಿತ ವಿಠಲಗೆ II ಪ II

    ಗೆಜ್ಜೆನಾದದ ಹೆಜ್ಜೆ ಇಕ್ಕುವ I ಉಡುಪಿ ಬಾಲ ಮುಕುoದಗೆ
    ರಂಗನಾಯಕಿ ರಮಣಗೆ I ಶ್ರೀ ರಂಗನಾಥ ಸ್ವಾಮಿಗೆ

    ಕಂಬದಿಂದಲಿ ಉದಿಸಿ ಬಂದ I ಕಮಲಪತಿ ನರಸಿಂಹಗೆ
    ವಾಮನ ವಟುವಾಗಿ ಬಂದಗೆ I ವೆಂಕಟಾಚಲ ವಾಸಗೆ

    ರುಕ್ಮಿಣೀಶ ಕೃಷ್ಣಗೆ I ಜಯ ಜಾನಕಿಪತಿ ರಾಮಗೆ
    ಜಗವ ಉದರದಿ ಧರಿಸಿಹ I ಜಯರಾಮವಿಠಲ ದೇವಗೆ


  411. Posted by Prasad on April 22, 2012 at 8:24 pm

    Hello Meera, Can you please share the lyrics of Adiyali Gajamukhane ( thank you.


  412. Adiyali gajamukhana arcisi. rAgA: nATa.

    Adiyali gajamukhana arcisi Arambhisalu Ava bage kAryatati siddhi goLisi
    mOdadim salisuva manadiSTava sAdhu janarella kELi sakala suraringe
    mAdhavanE nEmisippa I adhikArava Adaradinda avaravaroLu
    nindu kAryagaLa bhEda koLisade mALpa purandara viTTala


  413. chitra:
    Would you be kind enough to post the lyrics of the Arati song in English script? Thanks.


  414. Posted by kiran on April 24, 2012 at 3:34 am

    i need lali govinda lali lyrics writen by sripadarajaru plz….. give me


  415. Posted by Chitra on April 24, 2012 at 11:35 am

    yeah, sure Lakshmanji :

    Raaga: Hindola Taala: Thriputa

    Aaratiyanu belagire Shreedevi sahitha Vittalage

    Gejjenaadada hejje ikkuva udupi Baala Mukundage
    Ranganaayaki Ramanage, Shree Ranganatha Swamige

    Kambadindali udhisi bandha kamalapathi Narasimhage
    Vaamanaa vatuvaagi bandhage venkatachala vaasage

    Rukmineesha Krishnage jaya Jaanakipathi Raamage
    Jagava udaradhi darisiha Jaya Rama Vittala Devage


  416. Posted by Chitra on April 24, 2012 at 12:37 pm

    S. Sankara Narayananji…here is the song you aske for Indhu Shukravaara

    ಸರ್ವ ಮಂಗಳ ಮಾಂಗಲ್ಯೇ ಶಿವೆ ಸರ್ವಾರ್ತ ಸಾಧಕೆ
    ಶರಣ್ಯೇ ತ್ರಯ೦ಬಕೆ ದೇವಿ ನಾರಾಯಣಿ ನಮೋಸ್ತುತೆ

    ಇಂದು ಶುಕ್ರವಾರ ಶುಭವ ತರುವ ವಾರ
    ಸುಮಂಗಲಿಯರೆಲ್ಲಾ ನಿನ್ನ ಪೂಜಿಸುವ ಪುಣ್ಯವಾರ

    ಮುಂಜಾನೆಯ ಮಡಿಉಟ್ಟು ಕುಂಕುಮವ ಹಣೆಗಿಟ್ಟು
    ರಂಗೋಲಿಯ ಬಾಗಿಲಿಗಿಟ್ಟು ಹಣ್ಣು ಕಾಯಿ ನೀಡುವ ವಾರ

    ಮಲ್ಲಿಗೆ ಜಾಜಿ ಹೂಮಾಲೆ ಹಾಕಿ ಚಂದನ ಹಚ್ಚಿ ಸಿಂಗಾರ ಮಾಡಿ
    ಕರ್ಪೂರದಾರತಿ ನಿನಗೆ ಬೆಳಗಿ ಭಕ್ತಿಯಿ೦ದಲಿ ಭಜಿಸುವ ವಾರ

    ಸುವಾಸಿನಿಯರಿಗೆ ಕುಂಕುಮ ಹಚ್ಚಿ ಸಂಭ್ರಮದಿ೦ದ ಬಾಗಿಣ ನೀಡಿ
    ಸರ್ವ ಮಂಗಲೆಯ ಕೀರ್ತಿಯ ಹಾಡಿ ಸಕಲ ಭಾಗ್ಯವ ಬೇಡುವ ವಾರ

    Sarva Mangala Maangalye Shive Sarvaarta Saadake
    Sharanye Trayambake Devee Naaraayani Namostuthe

    Indhu shukravaara shubhava taruva vaara
    Sumangaliyarella ninna poojisuva punyavaara

    Munjaaneya madiuttu kumkumava hanegittu
    Rangoliya baagiligittu hannu kaaayi needuva vaara

    Mallige jaaji hoomaale haaki chandana hacchi singara maadi
    Karpoora daarati ninage belagi bhakti indali bajisuva vaara

    Suvaasiniyarige kumkuma hacchi sambramadindha baagina needi
    Sarva mangaleya keerthiya haadi sakala bhaagyava beduva vaara


  417. Posted by Chitra on April 24, 2012 at 2:16 pm

    S. Sankara Narayananji…here is the song you asked for aadi lakshmi devige aarathiya yetire

    ಆದಿಲಕ್ಷ್ಮಿ ದೇವಿಗೆ ಆರತಿಯ ಎತ್ತಿರೆ
    ಅರಿಶಿನ ಕುಂಕುಮ ಹಚ್ಚಿ ಹೂಮಾಲೆ ಹಾಕಿರೆ
    ಧಾನ್ಯಲಕ್ಷ್ಮಿಗೆ ನೀವು ಧೂಪ ದೀಪ ಹಚ್ಚಿರೆ
    ಕನಕಲಕ್ಷ್ಮಿಗೆ ನೀವು ನೈವೇದ್ಯವ ತನ್ನಿರೆ

    ಬಲದ ಕಾಲು ಮುಂದೆ ಇಟ್ಟು ಹೊಸಿಲು ದಾಟಿ ಬಾರಮ್ಮ
    ಭಾಗ್ಯ ತಾಯಿ ಮಾಂಗಲ್ಯ ಸೌಭಾಗ್ಯವ ನೀಡಮ್ಮ
    ಹಾಲು ತುಪ್ಪ ಹೊಳೆ ಹರಿಸಿ ಹರುಷ ಸುಖವ ತಾರಮ್ಮ
    ಧನ ಧಾನ್ಯವ ಕೊಟ್ಟು ಸಂತಾನ ಕರುಣಿಸಮ್ಮ

    ಕ್ಷೀರಾಬ್ದಿತನಯೇ ಆನಂದನಿಲಯೆ ವಿಷ್ಣುಪ್ರಿಯೆ ಬಾರೆ
    ಕಮಲನಯನೆ ನಿಜ ಕಮಲವದನೆ ಕಮಲಾಕ್ಷವಲ್ಲಭೆ ಬಾರೆ
    ಪುಷ್ಪಸುಗಂಧಿನಿ ಹರಿಣವಿಲೋಚನಿ ಕರುಣೆಯನ್ನು ತೋರೇ
    ಅನಂತರೂಪಿಣಿ ಚಿರಸುಖದಾಯಿನಿ ಇಷ್ಟಾರ್ಥವನೇ ತಾರೆ

    Aadhi Lakshmi Devige aaratiya ethire
    arishina kumkuma hacchi hoomaale haakire
    Dhaanyalakshmige neevu dhoopa deepa hacchire
    Kanakalakshmige neevu naivedyava thannire

    Baladha kaalu mundhe ittu hosilu daati baaramma
    Bhaagya thaayi maangalya sowbhaagyava needamma
    haalu tuppa hoLe harisi harusha sukava thaaramma
    dhana dhaanyava kottu santhaana karunisamma

    Ksheeraabdithanaye aanandanilaye vishnupriye baare
    kamalanayane nija kamalavadhane kamalaakshavallabhe baare
    pushpasugandhini hariNavilochani karuNeyannu thore
    anantharoopiNi chirasukhadaayini ishtaarthavane thaare


  418. Posted by lalitha on April 25, 2012 at 5:34 am

    I need yogi manege banda lyrics in kannda


    • Posted by Srividya on December 11, 2013 at 7:04 am

      ಯೋಗಿ ಮನೆಗೆ ಬಂದಾ I ಶ್ರೀ ಗುರುದೇವ ಮನೆಗೆ ಬಂದಾ II ಪ. II

      ಕಾಲಲಿ ಪಾದುಕ ಕೈಯಲಿ ದಂಡ I
      ಬಾಲ ರವಿಯ ಕಳೆಯ II ಅ. ಪ.II

      ಮಸ್ತಕದಲಿ ಜಡೆ ಶೋಭಿಸುತಿರಲು
      ಕಸ್ತೂರಿ ತಿಲಕ ಚಂದನ ಹಣೆಯಲ್ಲಿ
      ವಿಸ್ತಾರ ನಗೆ ಮೊಗದ II 1 II

      ಜೋಲುತಿರಲು ಕೊರಳೊಳು ರುದ್ರಾಕ್ಷ
      ಜೋಳಿಗೆ ಬಗಲಲಿ ತ್ರಿಲೋಕ ರಕ್ಷಾ
      ಕಾಷಾಯಾಂಬರದ II 2 II

      ಭಕ್ತ ಕಾಮ ಕಲ್ಪಧ್ರುವನೀತ
      ಸಚ್ಚಿದಾನಂದ ಶ್ರೀಗುರುದೇವ ದತ್ತ
      ಶಂಕರ ಗುರು ರೂಪ II 3 II

      ಕುರುದ್ವೀಪದಿ ಕೃಷ್ಣೆಯ ತಟದಲ್ಲಿ
      ಸರಸೀಜ ವಾಸಿಪ ಶ್ರೀಪಾದ ಯೋಗಿ
      ಪರಮ ಪುರುಷ ನರಹರಿ II 4 II

      Yogi manege banda I Shri gurudeva manege bada
      Kaalali paaduka kaiyali danda
      Baala raviya kaleya

      Mastkadali jade shobhisutiralu
      Kasthuri tilaka chandana haneyalli
      Vistaara nage mogada

      Joluthiralu koralolu rudraksha
      Jolige bagalali thriloka raksha

      Bhaktha kaama kalpadruvaneetha
      Sacchidananda gurudeva datta
      Shankara guru roopa

      Kurudweepadi krishneya tatadali
      Saraseeja vasipa sripada yogi
      Parama purusha narahari

      Can anybody post me the lyrics of ROMA ROMA KANNINALLI RAMA NAAMA – a popular song on Hanuman by Shri. Puttur Narasimha Nayak…?

      Thanks in advance.



      • Posted by meeraghu on December 13, 2013 at 9:54 am

        Thanks, Srividya. Will post on the main page.

      • Posted by meeraghu on December 13, 2013 at 4:22 pm

        Srividya, who is the composer of this song?

      • Posted by Srividya on December 18, 2013 at 4:19 am

        Sorry Meera…I have no idea…but I’ve heard this song in the tune similar to “Dasanaagu Visheshanaagu Dasanaagu Bhavapaasha neegu” sung by Shri. Puttur Narasimha Nayak.

        Also, I’m not sure if the lyrics is ROMA ROMA KANNINALLI RAMA NAMA or simply ROMA ROMADALLI RAMA NAAMA.


  419. Posted by swetha on April 25, 2012 at 6:21 am

    lali govinda lali lyrics


    • Posted by swetha on April 25, 2012 at 6:22 am

      lali govinda lali lyrics in kannada


      • Posted by Srividya on December 13, 2013 at 6:05 am

        Hi swetha…

        Is this what you were looking for?

        ಲಾಲಿ ಗೋವಿಂದ ಲಾಲಿ
        ಕೌಸಲ್ಯ ಬಾಲ ಶ್ರೀ ರಾಮ ಲಾಲಿ
        ಲಾಲಿ ಮುನಿವಂದ್ಯ ಲಾಲಿ
        ಜನಕೀರಮಣ ಶ್ರೀ ರಾಮ ಲಾಲಿ

        ಪದ್ಮ ರಾಗವ ಪೋಲುವ ಹರಿ ಪಾದ
        ಪದ್ಮವನು ತಮ್ಮ ಹೃದಯ
        ಪದ್ಮದಲಿ ನಿಲ್ಲಿಸಿ ಪಾಡಿ ತೂಗಿದರು
        ಪದ್ಮಿನಿ ಭಾಮಿನಿಯರು

        ಕನಕಮಯ ಖಚಿತವಾದ ತಲ್ಪದಲಿ
        ವನಜಭವ ಜನಕನಿರಲು
        ವನಜನಾಭನ್ನ ಪಾಡಿ ತೂಗಿದರು
        ವನಿತಾ ಮಣಿಯರೆಲ್ಲರು

        ಆನಂದ ಸದನದೊಳಗೆ ಗೋಪಿಯರು
        ಆ ನಂದ ಸುತನ ಕಂಡು
        ಆನಂದ ಭರಿತರಾಗಿ ತೂಗಿದರು
        ಆನಂದ ಭೈರವಿಯಿಂದ

        ಪಲ್ಲವ ಧರೆಯರೆಲ್ಲ ಈ ಶಿಶುವು
        ಸಲ್ಲಲಿತ ಗಾನದಿಂದ ತೂಗಿದರು
        ಕಲ್ಯಾಣಿ ರಾಗದಿಂದ

        ಇಂದುಧರ ಮಿತ್ರ ಜೋಜೋ ಶ್ರೀ ಕೃಷ್ಣ
        ಇಂದು ರವಿನೇತ್ರ ಜೋಜೋ
        ಇಂದು ಕುಲಪುತ್ರ ಜೋಜೋ
        ಪರಮಾತ್ಮ ಇಂದಿರಾ ರಮಣನೇ ಜೋಜೋ

        ತುಂಗ ಭವಭಂಗ ಜೋಜೋ ಪರಮಾತ್ಮ
        ರಂಗ ಕೃಪಾಂಗ ಜೋಜೋ
        ಮಂಗಳಾಪಾಂಗ ಜೋಜೋ
        ಮೋಹನಾಂಗ ರಂಗ ವಿಠ್ಠಲನೇ ಜೋಜೋ

  420. Posted by Veena Mahesh on April 25, 2012 at 7:02 am

    hi, can u please send lyrics of Adhi lakshmi ge arrthi


  421. Posted by Chitra on April 25, 2012 at 10:47 am

    Veena Maheshji, if you are asking for Aadhi Lakshmi devige aaratiya ethire lyrics, it has been posted just on april 24 in both English and kannada.


  422. Posted by praveen on April 28, 2012 at 10:52 pm

    any audio on lord krishna


  423. Posted by Meera Lakshmi Narasimhan on May 1, 2012 at 5:18 am

    Dear Meera,
    Great site.Wonderful service.
    These two lyrics have come on right time when festivities begin.Thank you for this fantastic service.A small request ,can anybody sing these lyrics and post it in you tube(just like the Keshava Nama and the rest) It would be very useful just as the other you tube songs have been.Thank You once again to all those involved (Smt Chitra,for posting these two songs and many more) and thanks esp to Smt Meera for her service.


  424. Posted by Chitra on May 2, 2012 at 10:37 am

    Praveenji….these are beautiful songs on Lord Shri Krishna


  425. Posted by kiran on May 16, 2012 at 3:43 am

    i want lyrics of pandara pura vembha puttanagara alli vittobha


  426. Posted by kiran on May 17, 2012 at 1:16 am

    i want the lyrics of pandrapuravembha puttanagara alli vittobha enuva


    • Posted by Prasanna L on May 21, 2012 at 9:51 am

      Hi Meera,

      Can you please share the lyrics of “Jo Jo Yashodaye Nanda Mukundane” by Purandaradasaru?

      Prasanna L


      • Posted by amma on May 30, 2012 at 9:37 pm

        To all of you,

        Here is the song Jo Jo Yashodeya nanda.
        The lyrics is so nice can’t get over it
        It is sung so nicely.

        ಜೋ ಜೋ ಯಶೋದೆಯ ನಂದ ಮುಕುಂದನೇ
        ಜೋ ಜೋ ಕಂಸ ಕೊಠಾರೀ
        ಜೋ ಜೋ ಮುನಿಗಳ ಹೃದಯ ಮಂದಿರ
        ಜೋ ಜೋ ಲಕುಮಿಯ ರಮಣ

        ೧) ಹೊಕ್ಕಳ ಭೂಮಿಯ ತಾವರೆ ಗಣಿ್ಣನ
        ಇಕ್ಕಿಟ್ಟ ಮಕರ ಕುಂಡಲದ ಜ್ಹಕ್ಕರೆ ಸುವಕದ
        ದಿನತೋಳಿ ಕುರುವಿನ ಚಿಕ್ಕ ಬಾಯಿ ಮುದ್ದುಮೊಗದ
        ಸೊಕ್ಕಿದ ಮದದರಿ ಯಂದದಿ ನೊಸಳಲಿ ಇಕ್ಕಿದ ಕಸ್ತೂರಿಯ ತಿಲಕ
        ರಕ್ಕಸ ನೆದೆ ತಲ್ಲಣ ಮುರವೈರಿ ಮಕ್ಕಳ ಮಾಣಿಕ್ಯ

        ೨) ಕಣ್ಣಾ ಬೆಳಗು ಪಸರಿಸಿ ನೋಡುತ ಹೊರೆಗಣ್ಣ ಮುಚ್ಚಿ ನಸುನಗುತ
        ಸಣ್ಣ ಬೆರಳು ಬಾಯೊಳು ಹೊಳೆಯುತ್ತ ಪನ್ನಗ ಶಯನ ನಾಟಕನೆ
        ನಿನ್ನ ಮಗನ ಮತ್ತೆ ನೋಡೆನುತ ಗೋಪಿ ತನ್ನ ಪತಿಗೆ ತೋರಿದಳು
        ಚಿನ್ನ ತನದ ಸೊಬಗಿನ ತಳಿಯೇ ಹೊಸರನ್ನ ಮುತ್ತಿನ ಬೊಂಬೆ

        ೩) ಬಿಡಿ ಕಾಲ್ಗಳ ಪಸರಿಸುತಲಿ ಗೋಪಿಯ
        ತೊಡೆಯ ಮೇಲೆ ಮಲಗಿ ಬಾಯಿ ತೆರೆಯೆ
        ಒಡಲೊಳು ಚತುರ್ದಶ ಭುವನ ಇರಲು ಕಂಡು
        ನಡುನಡುಗಿ ಕಣ್ಣ ಮುಚ್ಚಿದಳು
        ತಡೆಯದೆ ಅಡಿಗಳ ನಿಡುತಲಿ ಬಂದು ಮದದೆರ ಮುಖವ ನೋಡುತ ನಿಂತು
        ಕಾಡುದಾಯ ಸೋದರ ಪುರಂದರ ವಿಠ್ಠಲ ಬಿಡದೆ ರಕ್ಷಿಸು ಎನ್ನ ಸಲಹ ಬೇಕೆಂದು

  427. Posted by amma on May 24, 2012 at 11:06 pm

    This song is in the album
    “Thoogire Rangana Thoogire Krishna” by Ratnamala Prakash

    I have not found it in any book. Need to write it down by listening.


  428. Posted by Chitra on May 25, 2012 at 4:10 pm

    The lyrics to the song in Kannada.

    ತೂಗಿರೆ ರಂಗನ ತೂಗಿರೆ ಕೃಷ್ಣನ ತೂಗಿರೆ ಅಚ್ಯುತಾನoತನ
    ತೂಗಿರೆ ವರಗಿರಿಯಪ್ಪ ತಿಮ್ಮಪ್ಪನ ತೂಗಿರೆ ಕಾವೇರಿ ರಂಗಯ್ಯನ

    ನಾಗಲೋಕದಲ್ಲಿ ನಾರಾಯಣ ಮಲಗ್ಯಾನೆ
    ನಾಗಕನ್ನಿಕೆಯರು ತೂಗಿರೇ
    ನಾಗವೇಣಿಯರು ನೇಣು ಪಿಡಿದುಕೊಂಡು
    ಬೇಗನೆ ತೊಟ್ಟಿಲ ತೂಗಿರೇ

    ಇಂದ್ರಲೋಕದಲ್ಲಿ ಉಪೇಂದ್ರ ಮಲಗ್ಯಾನೆ
    ಇಂದು ಮುಖಿಯರೆಲ್ಲಾ ತೂಗಿರೇ
    ಇಂದ್ರ ಕನ್ನಿಕೆಯರು ಚಂದದಿ ಬಂದು
    ಮುಕುಂದನ ತೊಟ್ಟಿಲ ತೂಗಿರೇ

    ಆಲದೆಲೆಯ ಮೇಲೆ ಶ್ರೀಲೋಲ ಮಲಗ್ಯಾನೆ
    ನೀಲ ಕುಂತಳೆಯರು ತೂಗಿರೇ
    ವ್ಯಾಳ ಶಯನ ಹರಿ ಮಲಗು ಮಲಗು ಎಂದು
    ಬಾಲಕೃಷ್ಣ ಯ್ಯನ ತೂಗಿರೇ

    ಸಾಸಿರ ನಾಮನೆ ಸರ್ವೋತ್ತಮನೆಂದು
    ಸೂಸುತ್ತ ತೊಟ್ಟಿಲ ತೂಗಿರೇ
    ಲೇಸಾಗಿ ಮಡುವಿನೋಳ್ ಶೇಷನ ತುಳಿದಿಟ್ಟ
    ದೋಷ ವಿದೂರನ ತೂಗಿರೇ

    ಅರಳೆಲೆ ಮಾಗಾಯಿ ಕೊರಳ ಮುತ್ತಿನ ಹಾರ
    ತರಳನ ತೊಟ್ಟಿಲ ತೂಗಿರೇ
    ಸಿರಿದೇವಿ ರಮಣನೆ ಪುರಂದರ ವಿಠಲನೆ
    ಕರುಣದಿ ಮಲಗೆಂದು ತೂಗಿರೆ


  429. Posted by Chitra on May 25, 2012 at 4:13 pm

    The lyrics in English.

    Toogeere Rangana toogeere Krishnana toogeere Achyutananthana
    Toogeere Varagiriyappa Thimappana toogeere Kaveri Rangayyana

    Nagalokadalli Narayana Malagyane
    Naagakannikeyaru toogeere
    Nagaveniyaru Nenu Pididhukondu
    begane tottila toogeere

    Indra Lokadalli Upendra malagyane
    Indu Mukiyarella toogeere
    Indra Kannikeyaru chandadhi bandhu
    Mukundana tottila toogeere

    Aaladeleya mele ShriLola malagyane
    Neela Kunthaleyaru toogeere
    Vyala Shayana Hari malagu malagu endhu
    BalaKrishnayyana toogeere

    Saasira Naamane Sarvothamanendhu
    Soosutha tottila toogeere
    Lesaagi maduvinol Sheshana tulidhitta
    Dosha Vidhoorana toogeere

    Aralele Maagaayi korala muthinahaara
    Taralana tottila toogeere
    SiriDevi Ramanane Purandara Vittalane
    Karunadhi malagendhu toogeere


  430. Posted by amma on May 26, 2012 at 3:03 pm

    Thank you.
    I was referring to some ones posting of the song request “Jo Jo Yashodaye Nanda Mukundane” which is in the “Thoogire …” album ( and not the song thoogire.. itself)
    Thanks again for providing this also


  431. ರಾಗ : ಮೋಹನ

    ಬಾರೇ ಭಾಗ್ಯದ ನಿಧಿಯೆ ಕರವೀರ ನಿವಾಸಿನಿ ಸಿರಿಯೇ|
    ಬಾರೆ ಬಾರೆ ಕರವೀರ ನಿವಾಸಿನಿ ಬಾರಿ ಬಾರಿಗು ಶುಭ ತೋರೆ ನಮ್ಮನಿಗೆ ||

    ನಿಗಮ ವೇದ್ಯಳೆ ನೀನು ನಿನ್ನ ಪೊಗಳಲಾಪನೆ ನಾನು|
    ಮಗನಪರಾಧವ ಕಡೆಗಣಿಸದಲೆ ಪನ್ನಗವೇಣಿಯೆ ಲಗುಬಗೆಯಿಂದಲಿ ||

    ಲೋಕಮಾತೆಯು ನೀನು ನಿನ್ನ ತೋಕನಲ್ಲವೆ ನಾನು|
    ಆಕಳ ಕರುವಿನ ಸ್ವೀಕರಿಸುವ ಪರಿ ನೀ ಕರುಣದಿ ಕಾಲ್ಹಾಕು ನಮ್ಮನಿಗೆ ||

    ಕಡೆಗೇ ನಮ್ಮನಿವಾಸ ಒಡೆಯನಂತಾಧೀಶ|
    ಒಡೆಯನಿದ್ದಲ್ಲಿಗೆ ಮಡದಿ ಬಾಹುದೇ ರೂಢಿಗುಚಿತವಿದು ನಡಿ ನಮ್ಮನಿಗೇ ||

    ಶ್ರೀ ಅನಂತಾದ್ರೀಶರ ರಚನೆ


  432. Posted by bharathi on May 31, 2012 at 11:39 am


    Does anyone have the lyrics for Shringa Puradeeshwari Sharade?

    Thank you,



    • Posted by amma/bharathi on June 4, 2012 at 4:18 am

      Song: shRNga purAdIshwari
      Ragam: kalyANI
      Thalam: Adi
      Composer: Padmacharan


      shRNgapurAdIshwari shAradE
      shubha maNgalE sarvAbhIshta pradE


      shaNkara sannuta srI padma charagE
      sakala kalAdi shAradE varadE
      sadanenna thAyE sAmagAna priyE


      karuNi semma sruti gatigaLa mAtE
      kamanIya sapta swarasupUjitE
      sAmagAna kalA swarUpiNi
      kAmita dAyini kalyANi janani

      ಶೃಂಗ ಪುರಾ ದೀಶ್ವರಿ ಶಾರದೆ
      ಶುಭ ಮಂಗಳೇ ಸರ್ವಭಿಷ್ಟ ಪ್ರದೇ


      ಶಂಕರ ಸನ್ನುತ ಶ್ರೀ ಪದ್ಮ ಚರಗೆ
      ಸಕಲ ಕಾಲಡಿ ಶಾರದೆ ವರದೇ
      ಸದನೆನ್ನ ತಾಯೇ ಸಾಮಗಾನ ಪ್ರಿಯೆ


      ಕರುಣಿ ಸೆಮ್ಮ ಶ್ರುತಿ ಗತಿಗಳ ಮಾತೆ
      ಕಮನೀಯ ಸಪ್ತ ಸ್ವರಸುಪೂಜಿತೆ
      ಸಾಮಗಾನ ಕಲಾ ಸ್ವರೂಪಿಣಿ
      ಕಾಮಿತ ದಾಯಿನಿ ಕಲ್ಯಾಣಿ ಜನನಿ

      Anothr song you might be interested in

      Song: sangIta sAmrAjya
      Ragam: mOhanakalyANI
      Thalam: Adi
      Composer: Bangalore Ramamurti


      sangIta sAmrAjya sancAriNi
      shrngAra shrngEripura vAsini


      unnata pANDya kEraLa vAsini
      sannutashrI cakra madhya nivAsini
      kAlaDi shankara hrdaya nivAsini
      kAla pAlaka brahma vishvAsini


      gAndhAra pancama dhaivata rUpiNi
      niSAda madhyama sapta svarUpiNi
      mandAra kusum maNimaya tEjO
      mAdhurya mOhanakalyANi svarUpiNi

      Chittai Swaram

      S(N)(D)S ,RG, ,DPM GRS(N) | (D)SRG ,PD, ,S”ND PMGR ||
      GPMG ,,PM GS”ND ,,S”N | DG”R”S” ,PDR” S”NDP MGSR ||
      ,G,P D,GD ,RG, P,DS” | ,,DR” ,PDS” ,R”G”, R”G”,G” ||
      R”G”S”, ND,D PDP, MG,G | RGS, (N)(D),G” R”S”ND PMGR ||

      (lower octave swarams denoted by (), high octave denoted by “)

      Thank all bharathi


  433. Posted by bharathi on June 4, 2012 at 9:38 am

    Thank you so much.

    I am going to request my daughter’s dance teacher to teach her a dance for this song.



  434. Posted by amma/bharathi on June 4, 2012 at 4:43 pm

    kannda version of Sangeetha saamrajya

    ಹಾಡು: ಸಂಗೀತ ಸಾಮ್ರಾಜ್ಯ
    ರಾಗ : ಮೋಹನಕಲ್ಯಾಣಿ
    ತಾಳ : ಆದಿ
    ರಚನೆ : ಬೆಂಗಳೂರು ರಾಮಮೂರ್ತಿ

    ಸಂಗೀತ ಸಾಮ್ರಾಜ್ಯ ಸಂಚಾರಿಣಿ
    ಶೃಂಗಾರ ಶ್ರಿಂಗೇರಿ ಪುರ ವಾಸಿನಿ
    ಉನ್ನತ ಪಾಂಡ್ಯ ಕೇರಳ ವಾಸಿನಿ
    ಸನ್ನುತ ಶ್ರೀ ಚಕ್ರ ಮಧ್ಯ ನಿವಾಸಿನಿ
    ಕಾಲಡಿ ಶಂಕರ ಹ್ರದಯ ನಿವಾಸಿನಿ
    ಕಾಲ ಪಾಲಕ ಬ್ರಹ್ಮ ವಿಶ್ವಾಸಿನಿ
    ಗಾಂಧಾರ ಪಂಚಮ ದೈವತ ರೂಪಿಣಿ
    ನಿಷಾದ ಮಧ್ಯಮ ಸಪ್ತ ಸ್ವರೂಪಿಣಿ
    ಮಂದರ ಕುಸುಮ ಮಣಿಮಯ ತೇಜೋ
    ಮಾಧುರ್ಯ ಮೋಹನಕಲ್ಯಾಣಿ ಸ್ವರೂಪಿಣಿ
    ಚಿಟ್ಟೆ ಸ್ವರ
    ಸ (ನಿ )(ದ )ಸ ,ರಿಗ , ,ದ ಪ ಮ ಗ ರಿ ಸ (ನಿ ) | (ದ )ಸ ರಿ ಗ ,ಪ ದ , ,ಸ ”ನಿ ದ ಪ ಮ ಗ ರಿ ||
    ಗ ಪ ಮ ಗ ,,ಪ ಮ ಗ ಸ ”ನಿ ದ ,,ಸ ”ನಿ | ದ ಗ ”ರಿ ”ಸ ” ,ಪ ದ ರಿ ” ಸ ”ನಿ ದ ಪ ಮ ಗ ಸ ರಿ ||
    ,ಗ ,ಪ ದ ,ಗ ದ ,ರಿ ಗ , ಪ ,ದ ಸ ” | ,,ದ ರಿ ” ,ಪ ದ ಸ ” ,ರಿ ”ಗ ”, ರಿ ”ಗ ”,ಗ ” ||
    ರಿ ”ಗ ”ಸ ”, ನಿ ದ ,ದ ಪ ದ ಪ , ಮ ಗ ,ಗ | ರಿ ಗ ಸ , (ನಿ )(ದ ),ಗ ” ರಿ ”ಸ ”ನಿ ದ ಪ ಮ ಗ ರಿ ||
    ಕೆಳ ಸ್ಥಾಯಿ ಸ್ವರ () ಗಳಲ್ಲಿದೆ . ಹೆಚ್ಚು ಸ್ಥಾಯಿ ಸ್ವರ “ ಗಳಲ್ಲಿದೆ


  435. Posted by Guru Prasad on June 5, 2012 at 1:09 am

    Please help me download “” raghavendra guru rayara sevisiro”” song mp3


  436. Posted by lalitha on June 13, 2012 at 10:31 am

    I like this site very much and I took the print out of Mahishasura mardini slokam
    My name is lalitha Raja. Does any one know the lyrics of kanyaka parameshwari stotram in tamil. If so, please post it. Thanks.


  437. Posted by padma on June 17, 2012 at 3:31 am

    I would like to have the lyrics for the song kamala kamalanana mukha divija sumukha padayugalam by Sri vidhya prasanna thirtharu


  438. Posted by T.Raghavendra Rao, Pensioner, H No.16-2-752/21/7, Triveni nagar, Gaddiannaram, Hyderabad-500060 Andhra Pradesh on June 18, 2012 at 10:07 am

    Hi Meera,
    I am retired person. I found the blog very useful to know the lyrics to many dasara padas and devotional songs.
    Will you please help me to have a link to know meanings to Kannada lyrics into Telugu. Though we are Madhwas quite settled in Andhra Pradesh and have little knowledge of Kannada. Telugu/English meaning to Dasara Padas will really help our family members to understand the meaning while doing bhajan.


    • Posted by meeraghu on June 18, 2012 at 7:22 pm

      I understand, however I am not sure how I can help, since I don’t know or understand Telugu.


  439. Posted by mamos.bharathi on June 18, 2012 at 11:15 pm

    Hello Sri Raghavendra Rao,

    There is a person P.R.Ramachander though a Tamilian but like you lived in Bangalore all along
    He has a web site where he has so many songs of purandara dasa with English meaning. He has other great materials as well please take a look it might help
    Here is a link:



  440. Posted by hemamalini on June 27, 2012 at 10:07 am

    I want a tamil version of varahi ashtakam Eng version is very difficult for m e to pronounce the correct sound


  441. Posted by mamos.bharathi on June 29, 2012 at 10:39 am

    Hello Hemamalini,
    If you are any one that can help you, the tamil version varahi ashtakam( or anything) is easy to do by yourself.

    Here is how you can do. Go to and click on menu MORE arrow down, select tamil. Start typing it will automatically give you tamil version.


  442. Posted by veena raghavendra on July 4, 2012 at 2:41 am

    can I get lyrics for variraja virachita “Govinda Gopala Gopika Vallabha”


    • gOvinda gOpAla gOpikA. rAgA: tODi. tripuTa tALA.

      P: gOvinda gOpAla gOpikA vallabha
      C1: gOvardhanOddhAraka gOvardhanOddhAraka
      nArAyaNa acyuta nara mriga rUpa shrIpati shauri hari
      varijOdbhava vandya vandita caritra
      puramArdana mitra parama pavitra
      2: ina sashi lOcana indu nibhAnana yenuta kuNDala nAthana
      kanakamaya vAsana ghanapApa nAshana
      yenuta kuNDala nAtha vENunatha hayavadana


  443. Hello madam,
    I felt very happy when i have seen your posts. Please do add some more lyrics.
    hopefully you do ASAP.


  444. Posted by Ranjini on July 19, 2012 at 4:03 pm

    Hi Meera,

    I just got your website when I was searching for Sampath Shukruvara hadu ..this website is helpfull. Thank you

    Can you please upload the lyrics for ” Bandu nelesau Indire yennaya Mandiradolaganandadi”


  445. Hello Meera mam,
    Need your help to upload lyrics of Sampat Shukravarada Haadu. Earlier it was there in your website but now I am unable to find. Please help, my email ID is, also need help if you can send us the audio song.


  446. suuper fantastic thanks


  447. Posted by bhavana on August 8, 2012 at 9:18 am

    Dear Meera,

    I am in search of a kannada devotional song – sung by S. Janaki? Vani Jayaram? –

    I had heard this song during 1983 – 1988. I don’t know whether it was from a movie(kannada) or from devotional music cassette.
    I do not remember whether it starts with a shloka.
    I remember about 60% sahitya of the song and some lines are missing.
    Anyway i will write here whatever i remember and it may give you some clue.

    O mAte Srilalite SAradeye Shringagiri iLidu bA tAyi siridEvi
    sirigannadAmbe nee harasamma tAye ||

    jnAnAdhidEvate (p)ratirUpa mahAmAte rasakAvyarannara makutamNiye
    pampAdidAsara padajyothi neenamma gaganada siriyamma ee ninna gAmbheerya
    ninna nAmave bhakti jnAnasAdhana shakti
    Saranembe namisuve SAradamAte ||

    sangeetharasike karapadmabhUshini
    swararAga tAlalaya shrutigAna tumbutali


    ninna namave janani tungAnadi teertha
    nudisamma harasamma SAradamAte ||

    I need the lyrics as well as mp3 or video of the song.

    – Bhavana.


    • Posted by meeraghu on August 8, 2012 at 9:20 am

      Did you try searching Kannadaaudio? I am not aware of this song, if I find the lyrics I will definitely post it here.


      • Posted by bhavana on August 10, 2012 at 12:05 pm

        I didn’t get it in kannada audio. The main problem is I do not know whether it is from a movie or from devotional music cassette and I do not remember whether it starts with a shloka.
        I can sing the available lyrics but it is incomplete because of a few missing lines.

        I am searching an other song also. It is a bhavageethe.-

        Hareyada hasiranu chimmutha niriyolu
        shravana sundari bandaliga

    • Posted by Varsha on July 8, 2016 at 2:14 am

      I could fill in the swaras:
      Sa sa ni da ni da sa ni da pa ma ga ri ga ga,
      Ri ga ga ga ri ri ga ri ma sa ri ni ri sa sa
      Ni sa ni da ni ni sa da ni ma da ga ma
      Sa ga ri ma ga da ma ni da sa ni ri sa sa


  448. Posted by Veena Maniraj on August 9, 2012 at 3:14 am

    Hi Team,

    Can you please provide me the lyrics of the song panduranga twatpada palisiya in engish.

    Veena Maniraj


  449. Posted by sudheendra on August 11, 2012 at 6:30 am

    hi, I am Sudheendra, I m searching for the lyrics of the song”byasarade bhajisiro purandara dasa rayara,,,,, shersha nimmanu udasina madade poshisuva santoshadindali………… pls provide me the lyrics of this song…………


  450. Posted by Anand M R on August 16, 2012 at 12:05 am

    Dear Meera,

    Your hard work in consolidting & collating all the jewels of Devotional literature is highly appreciated. My mother was singing 2 laali songs for krishna. SHe has forgot the lyrics now and remembers only few lines. If you have it please share the lyrics for the following.
    1. The song has laali for all 10 avataras and starts like “Neelagana leela Jo Jo, balkrishna jo jo..and some lines like “Ananda sadhana dolagey nirmisdha pacheya totillalli”……and so on….and has ending of each para like “toogidharu Krishnavatra Hariya”, or “Toogidharu Ramavathra Haria ya and so on”…

    2. Laali for Krishna….. “Rohini nakshtarta shuba lagna dhalli”…and end each para.. “Thaai devaki bandhu toogidhru hariyaa laali”…it has one line as “Laali Ranga Vittala”.. so I asume that it is Sri. Vyasaraja’s work.

    Sorry if the description is very vague. Thanks in advance for your help.



    • ನೀಲ ಘನ ನೀಲ ಜೋ ಜೋ
      ಕರುಣಾಲವಾಲ ಶ್ರೀ ಕೃಷ್ಣ ಜೋ ಜೋ
      ಲೀಲಾವತಾರ ಜೋ ಜೋ
      ಪರಮಾತ್ಮ ಬಾಲ ಗೋಪಾಲ ಜೋ ಜೋ ||೧||

      ಇಂದುಧರ ಮಿತ್ರ ಜೋ ಜೋ
      ಪರಮಾತ್ಮ ಇಂದುರವಿ ನೇತ್ರ ಜೋ ಜೋ
      ಇಂದುಕುಲ ರತ್ನ ಜೋ ಜೋ
      ಪರಮಾತ್ಮ ಇಂದಿರಾರಮಣ ಜೋ ಜೋ ||೨||

      ಆಶ್ಚರ್ಯ ಜನಕವಾಗಿ ನಿರ್ಮಿಸಿದ
      ಪಚ್ಚೆಯಾ ತೊಟ್ಟಿಲಲ್ಲಿ ಅಚ್ಯುತಾನಂತನಿರಲು
      ತೂಗಿದರು ಮತ್ಸ್ಯಾವತಾರ ಹರಿಯ ||೩||

      ಧರ್ಮ ಸಂಸ್ಥಾಪನೆಂದು
      ನಿರವಧಿಕ ನಿರ್ಮಲಾಚರಿತನೆಂದು
      ವರ್ಮ ಕರ್ಮಗಳ ತಿಳಿದು
      ತೂಗಿದರು ಕೂರ್ಮಾವತಾರ ಹರಿಯ ||೪||

      ಸರಸಿಜಾಕ್ಷಿಯರೆಲ್ಲ ಜನವಶ್ಯ
      ಕರ ದಿವ್ಯ ರೂಪನೆಂದು
      ಪರಮ ಹರುಷದಿ ಪಾಡುತ
      ತೂಗಿದರು ವರಹಾವತಾರ ಹರಿಯ ||೫||

      ಕರಿಕುಂಭಗಳು ಪೋಲುವ
      ಕುಚದಮೇಲ್ ಹಾರ ಪದಕವು ಹೊಳೆಯಲು
      ವರ ವರ್ಣಿನಿಯರು ಕೂಡಿ
      ತೂಗಿದರು ನರಸಿಂಹ ರೂಪ ಹರಿಯ ||೬||

      ಭಾಮಾ ಮಣಿಯರು ಎಲ್ಲ
      ಜಗದೊಳಗೆ ಸೋಮನಿವನೆಂದು
      ಹೊಗಳಿ ನೇಮದಿಂದಲಿ ಪಾಡುತ
      ತೂಗಿದರು ವಾಮನ ರೂಪ ಹರಿಯ ||೭||

      ಸಾಮಜ ವರದನೆಂದು
      ಅತುಳ ಭೃಗು ರಾಮಾವತಾರನೆಂದು
      ಪ್ರೇಮದಿಂದಲಿ ಪಾಡುತ
      ತೂಗಿದರು ಭಾರ್ಗವ ರೂಪ ಹರಿಯ ||೮||

      ಕಾಮಿನಿಯ ಕಾಮನೆಂದು
      ಸುರಸಾರ್ವಭೌಮ ಗುಣಧಾಮನೆಂದು
      ವಾಮ ನೇತ್ರಿಯರು ಪಾಡಿ
      ತೂಗಿದರು ರಾಮಾವತಾರ ಹರಿಯ ||೯||

      ಸೃಷ್ಟಿಯಾ ಕರ್ತನೆಂದು
      ಜಗದೊಳಗೆ ದುಷ್ಟ ಸಂಹಾರನೆಂದು
      ದ್ರುಷ್ಟಾಂತ ರಹಿತನೆಂದು
      ತೂಗಿದರು ಕೃಷ್ಣಾವತಾರ ಹರಿಯ ||೧೦||

      ವೃದ್ಧ ನಾರಿಯರು ಎಲ್ಲ ಜಗದೋಳ್
      ಪ್ರಸಿದ್ಧನಿವನೆಂದು ಹೊಗಳಿ
      ತೂಗಿದರು ಬೌದ್ಧಾವತಾರ ಹರಿಯ ||೧೧||

      ಝಣ ಝಣತ್ಕಾರದಿಂದ ರಂಜಿಸುವ
      ಕುಸುಮ ಗಂಧಿಯರು ಕೂಡಿ
      ತೂಗಿದರು ಕಲ್ಕ್ಯಾವತಾರ ಹರಿಯ ||೧೨||

      ತುಂಗ ಭವಭಂಗ ಜೋ ಜೋ
      ಶ್ರೀ ಕೃಷ್ಣ ಮಂಗಳಾಪಾಂಗ ಜೋ ಜೋ
      ರಂಗ ಶ್ರೀಪಾಂಗ ಜೋ ಜೋ
      ಪರಮಾತ್ಮ ರಂಗವಿಠ್ಠಲನೆ ಜೋ ಜೋ ||೧೩||


  451. A wonderful all-in-one site for anyone who wants to feed his immortal “atma” in addition to just feeding his mortal ‘sharira’ in this most rarest and precious ‘manava janma……JAYATEERTH KOTY, from Nagarabhavi, Bangalore( presently at Santa Clara, CA)


  452. hi i wanted some gud lakshmi songs in kannda with lyrics plz help me …n guru ragavendra kannada bakthigeethe with lyrics i wanted to listen plz do help me n mail me…..


  453. lAli by Shripadaraya.

    niila ghana niila jO jO, kuruNaalavaala shrii kriShNa jO jO
    liilaavataara jO jO, paramaatma baala gOpaala jO jO

    indudhara mitra jO jO, paramaatma, induravi nEtra jO jO
    indukula ratna jO jO, paramaatma, indiraa ramaNa jO jO

    aascharya janakavaagi, nirmisida, paccheyaa toTTilalli
    achyutaanantaniralu, tuugidaru, matsyaavataara hariya

    dharma samsthaapanendu, niravadhika, nirmalaacharitanendu
    varma karmagaLa tiLidu, tuugidaru, kuurmaavataara hariya

    sarasijaakShiyaru ella, janavashya kara divya ruupanendu
    parama harShadi paaDuta, tuugidaru varahaavataara hariya

    karkumbhagaLu pOluva kuchadamEl haara padakavu hoLeyalu
    vara varNiniyaru kuuDi tuugidaru, narasimha ruupa hariya

    bhaamaa maNiyarella, jagadoLage sOmanivanendu hogaLi
    nEma dindali paaDuta tuugidaru, vaamana ruupa hariya

    saamaja varadanendu atuLa bhr^ugu raamaavataaranendu
    prEmadindali paaDuta tuugidaru, bhaargava ruupa hariya

    kaaminiya kaamanendu, surasaarvabhouma guNadhaamanendu
    vaama nEtriyaru paaDi tuugidaru, raamaavataara hariya

    sr^uShTiyaa kartanendu jagadoLage duShTa samhaaranendu
    dr^uShTaanta rahitanendu tuugidaru, kriShNaavataara hariya

    vr^uddha naariyaru yella jagadOL prasiddhanivanendu hogaLi
    baddhaanuraagadinda tuugidaru, bouddhaavataara hariya

    jhaNa jhaNatkaaradinda ranjisuva malayajaalEpadindu
    kusuma gandhiyaru kuuDi tuugidaru, kalkyaavataara hariya

    tunga bhava bhanga jO jO, shrii kriShNa, mangaLaaapaanga jO jO,
    ranga shrii paanga jO jO, paramaatma ranga-viTThalane jO jO


  454. Posted by Anand M R on August 17, 2012 at 10:47 am

    Hi Sri Lakshman, Thanks a lot for giving the lysrics of this song. I really like this song. IS this available in Kannada. It will help my my mother who can read kannada. Thanks again for your effort in providing the lyrics of this song.

    With warm regards


  455. I used Baraha to convert to Kannada but I cannot read the script. Some charaters might be incorrect.

    ನೀಲ ಘನ ನೀಲ. ರಾಗಾ: ಆನನ್ದಭೈರವಿ. ತ್/ಆದಿ ತಾಳಾ.

    ೧: ನೀಲ ಘನ ನೀಲ ಜೋ ಜೋ ಕರುಣಾಲವಾಲ ಶ್ರೀ ಕ್ರ್ಶ್ಣ ಜೋ ಜೋ ಲೀಲಾವತಾರ ಜೋ ಜೋ ಪರಮಾತ್ಮ ಬಾಲ ಗೋಪಾಲ ಜೋ ಜೋ
    ೨: ಇನ್ದುಧರ ಮಿತ್ರ ಜೋ ಜೋ ಪರಮಾತ್ಮ ಇನ್ದುರವಿ ನೇತ್ರ ಜೋ ಜೋ ಇನ್ದುಕುಲ ರತ್ನ ಜೋ ಜೋ ಪರಮಾತ್ಮ ಇನ್ದಿರಾರಮಣ ಜೋ ಜೋ
    ೩: ಆಸ್ಚರ್ಯ ಜನಕವಾಗಿ ನಿರ್ಮಿಸಿದ ಪಚ್ಚೆಯಾ ತೊಟ್ಟಿಲಲ್ಲಿ ಅಚ್ಯುತಾನನ್ತನಿರಲು ತೂಗಿದರು ಮತ್ಸ್ಯಾವತಾರ ಹರಿಯ
    ೪: ಧರ್ಮ ಸಮ್ಸ್ಥಾಪನೆನ್ದು ನಿರವಧಿಕ ನಿರ್ಮಲಾಚರಿತನೆನ್ದು ವರ್ಮ ಕರ್ಮಗಳ ತಿಳಿದು ತೂಗಿದರು ಕೂರ್ಮಾವತಾರ ಹರಿಯ
    ೫: ಸರಸಿಜಾಕ್ಶಿಯರೆಲ್ಲ ಜನವಶ್ಯ ಕರ ದಿವ್ಯ ರೂಪನೆನ್ದು ಪರಮ ಹರ್ಶದಿ ಪಾಡುತ ತೂಗಿದರು ವರಹಾವತಾರ ಹರಿಯ
    ೬: ಕರಿಕುಮ್ಭಗಳು ಪೋಲುವ ಕುಚದಮೇಲ್ ಹಾರ ಪದಕವು ಹೊಳೆಯಲು ವರ ವರ್ಣಿನಿಯರು ಕೂಡಿ ತೂಗಿದರು ನರಸಿಮ್ಹ ರೂಪ ಹರಿಯ
    ೭: ಭಾಮಾ ಮಣಿಯರು ಎಲ್ಲ ಜಗದೊಳಗೆ ಸೋಮನಿವನೆನ್ದು ಹೊಗಳಿ ನೇಮ ದಿನ್ದಲಿ ಪಾಡುತ ತೂಗಿದರು ವಾಮನ ರೂಪ ಹರಿಯ
    ೮: ಸಾಮಜ ವರದನೆನ್ದು ಅತುಳ ಭ್ರುಗು ರಾಮಾವತಾರನೆನ್ದು ಪ್ರೇಮದಿನ್ದಲಿ ಪಾಡುತ ತೂಗಿದರು ಭಾರ್ಗವ ರೂಪ ಹರಿಯ
    ೯: ಕಾಮಿನಿಯ ಕಾಮನೆನ್ದು ಸುರಸಾರ್ವಭೌಮ ಗುಣಧಾಮನೆನ್ದು ವಾಮ ನೇತ್ರಿಯರು ಪಾಡಿ ತೂಗಿದರು ರಾಮಾವತಾರ ಹರಿಯ
    ೧೦: ಸ್ರುಶ್ಟಿಯಾ ಕರ್ತನೆನ್ದು ಜಗದೊಳಗೆ ದುಶ್ಟ ಸಮ್ಹಾರನೆನ್ದು ದ್ರುಶ್ಟಾನ್ತ ರಹಿತನೆನ್ದು ತೂಗಿದರು, ಕ್ರ್ಷ್ಣಾವತಾರ ಹರಿಯ
    ೧೧: ವ್ರುದ್ಧ ನಾರಿಯರು ಯೆಲ್ಲ ಜಗದೋಳ್ ಪ್ರಸಿದ್ಧನಿವನೆನ್ದು ಹೊಗಳಿ ಬದ್ಧಾನುರಾಗದಿನ್ದ ತೂಗಿದರು ಬೌದ್ಧಾವತಾರ ಹರಿಯ
    ೧೨: ಝಣ ಝಣತ್ಕಾರದಿನ್ದ ರನ್ಜಿಸುವ ಮಲಯಜಾಲೇಪದಿನ್ದು ಕುಸುಮ ಗನ್ಧಿಯರು ಕೂಡಿ ತೂಗಿದರು ಕಲ್ಕ್ಯಾವತಾರ ಹರಿಯ
    ೧೩: ತುನ್ಗ ಭವ ಭನ್ಗ ಜೋ ಜೋ ಶ್ರೀ ಕ್ರ್ಶ್ಣ ಮನ್ಗಳಾಪಾನ್ಗ ಜೋ ಜೋ ರನ್ಗ ಶ್ರೀ ಪಾನ್ಗ ಜೋ ಜೋ ಪರಮಾತ್ಮ ರನ್ಗವಿಟ್ಠಲನೆ ಜೋ ಜೋ


  456. Posted by Gopal on August 26, 2012 at 11:39 pm

    Madam, i am looking for ” yeshtu helali venkatagiriya srushtige bhahu siriya ” song script please send me if you have,,

    Thanking you


  457. तुन्गा तीरदि. रागा: भूपालि.

    फ: तुन्गा तीरदि निन्तसुयतिवर न्यारॆ पॆळम्मा
    आ: सन्गीत प्रिय मन्गळ सुगुण तरग मुनि कुलॊत्तुन्ग काणम्मा
    छ्१: चेलुव सुमुख फणेयल्लि तिलक नामगळु नॊडम्म
    जलज मनुज कोरळल्लि तुलसि मालेगळु पॆळम्म
    सु-ललित कमण्डलु दण्डवन्ने धरिसिहने नॊडम्म
    क्षुल्ल हिरण्यकनल्लि जनिसिद प्रह्लादनु तानिल्लिह नम्म
    २: सुन्दर चरणारविन्दके भकुतियलिन्द नॊडम्म
    वन्दिसि स्तुतिसुव भूसुर व्रिन्द नॊडम्म
    चन्ददलन्क्र्तियिन्द कमन्दिगळ वसदिन्द रहितने
    ३: अभिनव जनार्दन विठलन ध्यानिसुव नॊडम्म
    अभिवन्दिसिवरिगे अखिलथव सल्लिसुव नॊडम्म
    नभमणियन्ददि विविधदि शॊभिसुव नॊडम्म
    शुभ गुणगण निधि राघवॆन्द्र गुरु
    अम्बुज भवाण्डदि प्रवळ काणम्म


  458. Posted by Guru on August 28, 2012 at 11:05 pm

    Hello Madam,

    Can u pls post the lyrics of nambi kettavarillavo ee gurugala in kannada?



  459. Posted by Varsha Gopi on September 5, 2012 at 5:30 am

    I love this website. I m having a 4 month baby, n was searching for the song “jo jo Shri krishna pramananda”, n here I found all my fav songs. Thank u:-)


  460. Posted by Ravindranath on September 16, 2012 at 1:38 am

    Is it possible for you to provide lyrics in English for UDUPI KRISHNA Dasaru Kriti by Sri Vidyabhushana – will be obliged. Thanks. @raviseetha


  461. Posted by B.K. Vasuki on September 17, 2012 at 12:30 am

    Lyrics of Yesukalangala


  462. Posted by neelesh pai on September 17, 2012 at 7:19 am

    |Shri Mukhya Praanantargata Laxmi Venkatesho Vijayate|
    |Shri Rama Deva Veera Vitthala Prasannaha|

    Lyrics By: Shri Jagannathadaasaru

    Nambi Kettavarillavo e gurugala, nambade keduvarunto
    nambida janarige bembala taanagi, hambalisida phala tumbi koduvaranna
    Nambi Kettavarillavo e gurugala, nambade keduvarunto

    Jaladhara dwijavarage, taane olidu sulabha mukutiyanittano.
    Cheluva sutana padeda,lalanege pararinda pulinagartadi divya jalavanitaavaranna
    Nambi Kettavarillavo e gurugala, nambade keduvarunto

    Mrutyu dootaru tannanu pondidanijadhrutyana karedoyyalu
    satta dvijana taanu matte dharege tandu ,mrutyu bidisi sukha ittu porediharanna
    Nambi Kettavarillavo e gurugala, nambade keduvarunto

    Dittaguru jagannath vitthalanolume ghatanavaadudarinda
    Ghatanaghatana kaarya ghatana maaduvo namma patuguruvara hrutpatadiruvoranna
    Nambi Kettavarillavo e gurugala, nambade keduvarunto.


  463. Can someone transliterate the song, into English, from this link? I tried Baraha but it did not work. Thanks.


  464. Hi Meera,

    I am looking for the following song lyrics:

    1. Hege mechi saali acchi ninna.. nagashayanane narada vandhyane
    2.Varava kodamma devi saubhagyada varava kodamma thaye
    3.jayathu jaya ganapa ninna dyaanipa..
    4.thirupathi venkata ramana ninage ethaku baaradu karuna.
    5.Mangala maha gouri ranga sahodri gangadarana rani sri gowri
    6.ammana kandira jagadambya kandira durgaya kandira bhadra kaliya kandira

    These were sung by my dodda’s ( granny).. would be grateful
    if any of these i can get 🙂

    U r doing an excellent job!!!!!


    • Posted by Nandini on August 2, 2016 at 7:57 am

      hi lekshmy puranik,

      I got the lyrics from my grandma. Happy singing 🙂
      ಮಂಗಳ ಮಹಾಗೌರಿ ರಂಗನ ಸಹೋದರಿ
      ಗಂಗಾಧರನ ರಾಣಿ ಶ್ರೀಗೌರಿ||

      ಮೂತಿನ ಮೂಗುತಿ ಕೊಡೆ
      ರತ್ನದ ವಾಲಿ ಕೊಡೆ
      ಮುತೈದೆ ತನ ಕೊಟ್ಟು ಕಾಪಾಡೆ||

      ವಂಕಿ ಬಳೆ ಕೊಡೆ
      ಕಂಕಣ್ಣ ಋಣಿ ಕೊಡೆ
      ಕುಂಕುಮ ಅರಿಶಿನ ಕೋಟು ಕಾಪಾಡೆ||

      ಪರಿಮಳದ ಪುಷ್ಪ ಕೊಡೆ
      ಜರತಾರಿ ಸೀರೆ ಕುಪ್ಪಸ ಕೊಡೆ
      ತರುಣಿಯರೊಡಗೂಡಿ ಮಾತಾಡೆ||

      ಅನ್ನ ವಸ್ತ್ರವ ಕೊಡೆ
      ಚಿನ್ನದ ಹೊನ್ನು ಕೊಡೆ
      ಸಡಗರ ಸಂಪಾತು ಕೊಟ್ಟು ಕಾಪಾಡೆ||


    • Posted by Nandini on August 2, 2016 at 9:28 am

      Youtube link of my grandma singing it,


  465. Here are two of the songs you requested:

    hEge meccisali. rAgA: shankarAbharaNa. tripuTa tALA.

    P: hEge meccisali arcisali ninna nAgashayanana nArada vandyane dEva
    C1: mangaLAbhiSEkake udaka taruvenene gangeyunguSTadi paDediruve
    sangIta kIrtane pADuvenendare tumburu nAradaru pADutiharO dEva
    2: puSpava tandu ninagarpisuvenendare puSpa pallaviside hokkuLali
    ippatettisakOTi dEvargaLadanoppi naivEdya nIDalu trptanAguve
    3: kOTi sUryara prabhe migilAdAtanigondu dIpavanu haccidare beLagahude
    sATi kANade lakSmi ura sthaLavAgire lOSTa kAsu endu kANike nIDelo
    4: hAsigEyanu tandu hAsuvenendare shESana mEle nI pavaDisirpe
    bIsaNigeya tandu bIsuvenendare bIsutihanu khaga tanna pakkadali
    5: nitya guNArNva nija guNa paripUrNa saccidAnanda sanakAdi vandya
    muktidAyaka namma purandara viTTla bhakti dAyakanendu stutisi koNDADuveno

    tirupati vEnkaTaramaNa. rAgA: kharaharapriyA. Adi tALA.

    P: tirupati vEnkaTaramaNa ninagyAtake bAradu karuNa
    A: nambide ninnaya caraNa paripAlisa bEkO karuNa
    C1: aLagiriyindalli banda svAmi anjanagiriyali ninda
    koLalu dhvaniyudO canda namma kuNDalarAya mukunda
    2: bEDeyADuta banda svAmi beTTada mEle ninda
    vITugAra gOvinda alli jEnu sakkareyanu tinda
    3: mUDala giriyali ninda muddu vEnkaTapati balavanta
    Idilla ninage shrIkAnta IrELu lOkakananta
    4: Adidare sthiravappa abhaddagaLADalu oppa
    bEDida varagaLinippa namma mUDalagiri timmappa
    5: appavu atirasa metta svAmi asurara kAlali odda
    satiya kUDADutalidda svAmi sakala durjanaranu gedda
    6: bage bage bhakSya paramAnna nAnA bageya sakala shAlyanna
    bage bage sobagu mOhanna namma nagumukhada suprasanna
    7: kAshi rAmEshvaradinda alli kANike baruvudu canda
    dAsara kUDe gOvinda alli dAri naDevude canda
    8: ellA dEvara gaNDa ava cillare daivada miNDa
    ballidavarige uddaNDa shiva billa murida pracaNDa
    9: kAsu tappidare paTTi baTTi kAsu biDade kaNDu kaTTi
    dAsanendare biDa gaTTi namma kEsakki timmappasetti
    10: dAsara kaNDare prANa tA dhareyoLadhika pravINa
    dvESiya gaNDala kANa namma dEvage nitya kalyANa
    11: mOsa hOguvanallayya ondu kAsige oDDuva kayya
    Esu mahimegAranayya namma vAsudEva timmayya
    12: cittAvadhAna parAku ninna cittada daya ondE sAku
    satyavAhini ninna vAku nInu sakala janarige bEku
    13: allalli pariSeya gumbu mattallalli tOpina tampu
    allalli sogasina sompu mattallalli parimaLadimpu
    14: allalli janagaLa kUDa mattallalli brAhmaNarUTa
    allalli piDida kOlATa mattallalli uRige Ota
    15: pApa vinAshini snAna hari pAdOdakave pAna
    kOpa tApagaLa nidhAna namma purandara viTTalana dhyAna


  466. Posted by Vasantha on September 19, 2012 at 11:56 pm

    Hi Meera,
    Great work on your site. Here is the lyrics for Bhadrapada Shukladha devotional song by Vijaya Narasimha. He was a genius and awesome kannada song writer. The lyrics lines follows the song by PB Srinivas and S Janaki.

    bhaadhrapadha shukladha chowthiyandhu
    chandhirana nodidhare apavaadha thappadhu
    bhaadhrapadha shukladha chowthiyandhu
    chandhirana nodidhare apavaadha thappadhu
    naraveshadhaari hari krishnanaa ididhu uluvantha nararigu idhu benna bidadhu

    yaadhava kulavanu paavanadholisi udhisidha maadhava madhureyaliee
    yaadhava kulavanu paavanadholisi udhisidha maadhava madhureyaliee
    gollanenisi thana kallanenisidhava govardhana giridhaari
    chowthiya chandrana kaanutha irulali alukidha krishnanu manadhalliee

    raaja rushiyaa sathraajithanige doreyithu anupama dhivya maniee
    thapasige mechhi needidha varavanu karuna mayanaa dhina maniee
    raaja rushiyaa sathraajithanige doreyithu anupama dhivya maniee
    thapasige mechhi needidha varavanu karuna mayanaa dhina maniee

    yaadhavarondhige betege odhanu krishanu kaadinaliee
    simhavu kondhithu ratna dhaariya padeyalu divya maniee

    krishnanobbane hindhake baralu shenkeyu moodithu janaralli
    krishnanobbane hindhake baralu shenkeyu moodithu janaralli
    amoolya maniyanu krishnane kalla yennuva salladha nudi keliee

    krishnanu thaaladhe maniyanu hudukutha horatanu adaviyaliee
    kandanu krishnanu suryana maniyanu karadiya guheyalliee

    jaambavanthana magalu jaambavathi baliyall-iddithu surya maniee
    gora yuddhava maadi koneyanu kaanadhe nindha veeragraniee

    jaambavanthanige ramanaagi sri krishna kandu bandhaa
    jaambavanthanige ramanaagi sri krishna kandu bandhaa
    horaata nedesidha thappigaagi jaambavantha nondhaa
    horaata nedesidha thappigaagi jaambavantha nondhaa

    maniyanithhu magalannu ithhu tha sharanu sharanu yendhaa
    shyamanthaka maniyanu kanda yadhukula hogalithu krishnana olavindhaa

    krishna jaya hari krishna jaya madhava raadha loala jaya
    krishna jaya hari krishna jaya madhava raadha loala jaya

    chowthiya chandrana dharshanadhindha kaadithu krishnana apavaada
    ee kathe kelalu dhorevudu janarige doshada pariharaa
    chowthiya chandrana dharshanadhindha kaadithu krishnana apavaada
    ee kathe kelalu dhorevudu janarige doshada pariharaa

    ganapathi olumege pathraraagalu idhuve sulaba vidhaanaa
    ganapathi olumege pathraraagalu idhuve sulaba vidhaanaa
    karya siddhiya olle buddhiya koduvanu harasutha gajaananaa

    gajaananam bhootha ganaadhi sevitham
    kapittha jamboo phalasaara bhakshitham
    umaa sutham shoka vinaasha kaaranam
    namaami vigneshwara paadha pankajam


  467. Posted by Keerthi on September 20, 2012 at 3:13 am

    Sir i need vijayaprada sthothram, which is given to arjuna by Hanuman swami at kurukshethra battlefield


  468. Posted by Gopal on September 20, 2012 at 6:01 am

    i am looking for ” Yesthu helali vankatagiriya, shrustige bhahu siriya ” song , madam please give me the lyrics of this song..


  469. vaishnav jan to cool stuff where do u get those from though i love ’em


  470. Dear Meera,
    Kindly post the lyrics for the song ‘Hari sarvottama, vaayu jeevottama guru raghavendrarindari manave’.
    Thanks in advance.


  471. Posted by Ranjini on September 22, 2012 at 4:31 am

    please add the lyrics for these two songs……………..
    1) Sevakanelo naanu ninnaya paada seve nedelo neenu by Shri Vaadirajaru
    2) Muniya nodiro mukuti Dhanava bediro by Shri Gopala daasaru
    im not getting these song lyrics anywhere………..
    So,pls pls add the lyrics of these two songs……………..


  472. Posted by chithra on September 28, 2012 at 9:00 am

    Excellent and very useful site. Can u pls give me the lyrics of Purandaradasa keerthana Narayana Enniro in English and meaning for this song.



    • Posted by bhavana on November 13, 2012 at 9:24 am

      nArAyaNa ennirO, shrI narahari pArAyaNa mADirO|
      nArAyaNaneMdu ajamiLanu kaivalya
      sEridaneMbo suddi kELi ariyirA ||

      kAshige hOgalEke, kAvaDi pottu bEsattu tirugalEke
      vAsudEvana nAma bAytuMba nenedare
      klEshagaLeMbudu lEsha mAtravilla ||

      chOrara bhayavillavo, harinAmakke yAra aMkeyillavo
      UranALuva dhore nIti bhItigaLilla
      ghOrapAtakavella dUra mADuvudakke ||

      snAnava mADalEke, mAnavarige mouna maMtragaLEke
      dInapAlaka namma beTTadoDeyana
      dhyAnake sariyuMTe puraMdara viThalana ||


  473. Posted by Madhavi on October 15, 2012 at 3:31 pm

    hi , Love your site . Looking for Jagannatha dasara Shri lakshmi hrudaya lyrics sung puttur narashimha nayak . As from tomorrow its Dasara festival need to chant the stotra along with narayana varma . can you pls upload it . Thank you


  474. Posted by Madhavi on October 16, 2012 at 6:21 am

    Hi ,
    Thank u for your prompt reply . Yes , i did downloaded your version of Sri vadirajaru . The one I’ve mentioned is from Jagannatha Dasaru . Its on Kannadaaudio .com sung by Narasimha nayak , wanted the lyrics .


  475. Namaskara Ma’m. I need “chinteyake maduthi Shri Chinmayaniddanae ” lyrics. I did search but couldn’t find it though. Thanks in advance.


    • Please note: these are not the original lyrics.It is according to the Song sung by P.N.Nayak, I dont have d Original lyrics,I have read the original lyrics but dont have it now,I’ll try uploading it as I get it.

      Chintyaake maadutiddi Chinmayniddane,
      ninna chinteya bidisuva gauri kaantaniddane.

      Ellu koneyu mullu moneyu pollu bidada olage horage,
      ella thavinallu gauri vallabha niddane.

      Hinde ninna salahidaryaaru,munde ninna salahuvaryaaru,
      andindendendigu(andu+ indu+ endu+endigu) nandi vaahananiddane.

      nanu neenu emba ubhaya heena gunagalanna toredu,
      Jnaani chidananda sukha sampoornaniddane.


  476. You can hear the song here:


  477. Thanks so much Meera avare…I remember the lyrics which goes on praising lord Govinda..Probably there’s more than one variation to this song… But again thanks a lot.


    • The original Lyrics by Shree Purandara Dasaru

      ಚಿಂತ್ಯಾಕೆ ಮಾಡುತಿದ್ದಿ ಚಿನ್ಮಯನಿದ್ದಾನೆ ,ಪ್ರಾಣಿ ಚಿನ್ಮಯನಿದ್ದಾನೆ
      ಚಿಂತಾರಾತ್ಮನೆಂಬೊ ಅನಂತನಿದ್ದಾನೆ,ಪ್ರಾಣಿ ಅನಂತನಿದ್ದಾನೆ.

      ಎಳ್ಳು ಮೊನೆಯ ಮುಳ್ಳು ಕೊನೆಯ ಪೋಳ್ಳು ಬಿಡದೆ ಒಳಗೆ ಹೊರಗೆ

      ಎಲ್ಲ ಠಾವಿನಲ್ಲು ಲಕುಮಿ ನಲ್ಲನಿದ್ದಾನೆ,

      ಭೋಕ್ತ ,ತ್ರಿಜಗ ವ್ಯಾಪ್ತ ,ಭಜಕರ ಆಪ್ತನೆನಿಸಿ ಸ್ತಂಭದಲ್ಲಿ ,

      ಪ್ರಾಪ್ತನಾದ ಪ್ರಃಹಲಾದನ ಪರಮಾತ್ಮನಿದ್ದಾನೆ.

      ಹಿಂದೆ ನಿನ್ನ ಸಲುಹಿದರ್ಯಾರು, ಮುಂದೆ ನಿನ ಕೊಲ್ಲುವವರ್‍ಯಾರು

      ಅಂದಿಗ್ ಇಂದಿಗ್ ಎಂದೆಂದಿಗೂ ಗೋವಿಂದನಿದ್ದಾನೆ,

      ನಾನು ನನ್ನದು ಎಂಬುದು ಬಿಟ್ಟು ಹೀನ ವಿಷಯಂಗಳನೆ ಜರಿದು,

      ಜ್ಞಾನಗಮ್ಯ ಕಾಯೋ ಎನಲು ಪೂರ್ಣನಿದ್ದಾನೆ ಪ್ರಾಣಿ.

      ಸುತ್ತಲಿ ಬಂದ ದುರಿತಗಳೆಲ್ಲ ಕತ್ತರಿಸಿ ಕಡಿದು ಹಾಕುವ,

      ಹೆತ್ತ ತಾಯಿ ತಂದೆ ತವರು ಹತ್ತಿಗನಿದ್ದಾನೆ,

      ಬಳಿದ ಭಜಕರ ಹೃದಯದಲಿ ನಿಂತು ಮುದ್ದು ಪುರಂದರ ವಿಠಲ

      ಸೋಲ್ಲೂ ಸೋಲ್ಲಿದವರ ಬಯಕೆ ಸಲ್ಲಿಸುತಿದ್ದಾನೆ, ಪ್ರಾಣಿ.


  478. Posted by vinod on October 30, 2012 at 1:17 am

    Hi Meera,

    The hardship taken by you to keep this good job going cannot be expressed by mere words.I really dont know how to express…..:)
    Would you be able to upload swamy mukhyaprana composition of sri purandara dasaru…..



  479. Posted by guruprasath on October 30, 2012 at 12:55 pm

    can any one provide me rayaru gadhya if its in devanagari its better otherwise even its in english ok


  480. svAmi mukhya prANa nI. rAgA: Anandabhairavi. Adi tALA.

    P: svAmi mukhya prANa nI malevara gaNDala gANa sakala vidyA pravINa nI hiDidyO rAma a caraNa
    C1: sanjIvini parvatavannu anjade tandeyO nInu anjane tanu sambhavanu ninna bEDi kombEnO nAnu
    2: vaikuNTha sthaLadinda bandu pampA kSEtradi nindu yantrOddhArakanendu purandara viTTalane sahanendu


    • Posted by meeraghu on October 30, 2012 at 6:14 pm

      Can we get this in Kannada?


      • Posted by bhavana on November 13, 2012 at 7:23 am

        ಸ್ವಾಮಿ ಮುಖ್ಯಪ್ರಾಣ ನೀ ಮಲೆವರ ಗಂಟಲಗಾಣ ||ಪ||
        ಸಕಲ ವಿದ್ಯಾಪ್ರವೀಣ ನೀ ಹಿಡಿದೆಯೊ ರಾಮರ ಚರಣ ||ಅ.ಪ||

        ಏಕಾದಶೀಯ ರುದ್ರ ನೀ ಹಿಡಿದೆಯೋ ರಾಮರ ಮುದ್ರ
        ಸೇತುವೆಗಟ್ಟಿ ಸಮುದ್ರ ನೀ ಹಾರಿದೆಯೋ ಬಲಭದ್ರ ||೧||

        ಸಂಜೀವಿನಿ ಪರ್ವತವನ್ನು ಅಂಜದೆ ತಂದೆಯೋ ನೀನು
        ಅಂಜನೆತನುಸಂಭವನು ನಿನ್ನ ಬೇಡಿಕೊಂಬೆನೊ ನಾನು ||೨||

        ವೈಕುಂಠಸ್ಥಳದಿಂದ ಬಂದು ಪಂಪಾಕ್ಷೇತ್ರದಿ ನಿಂದು
        ಮಂತ್ರೋದ್ಧಾರಕನೆಂದು ಪುರಂದರವಿಠಲನೆ ಸಲಹೆಂದು ||೩||

        (ಆಕರ ಗ್ರಂಥ: ಪುರಂದರ ಸಾಹಿತ್ಯ ದರ್ಶನ)

        You can listen the song here:

  481. Posted by lakshmi baharthi on November 14, 2012 at 8:17 pm

    ನಾರಾಯಣ ಎನ್ನಿರೋ , ಶ್ರೀ ನರಹರಿ ಪಾರಾಯಣ ಮಾಡಿರೋ
    ನಾರಾಯನನೆಮದು ಅಜಾಮಿಳನು ಕೈವಲ್ಯ
    ಸೇರಿದನು ಎಂಬೋ ಸುದ್ದಿ ಕೇಳಿ ಅರಿಯಿರಾ ||

    ಕಾಶಿಗೆ ಹೋಗಲೆಕೆ , ಕಾವಡಿ ಪೊಟ್ಟು ಬೇಸತ್ತು ತಿರುಗಲೇಕೆ
    ವಾಸುದೇವನ ನಾಮ ಬಾಯ್ತುಂಬ ನೆನೆದರೆ
    ಕ್ಲೆಶಗಳೆಂಬುದು ಲೇಶ ಮಾತ್ರವಿಲ್ಲ ||

    ಚೋರರ ಭಯವಿಲ್ಲವೋ , ಹರಿನಮಾಕ್ಕೆ ಯಾರ ಅಂಕೆಯಿಲ್ಲವೋ
    ಉರನಾಳುವ ಧೊರೆ ನೀತಿ ಭಿತಿಗಲಿಲ್ಲ
    ಘೋರಪತಕವೆಲ್ಲ ದೂರ ಮಾಡುವುದಕ್ಕೆ ||

    ಸ್ನಾನವ ಮಾಡಲೇಕೆ , ಮಾನವರಿಗೆ ಮೌನ ಮಂತ್ರಗಲೇಕೆ
    ದಿನಪಾಲಕ ನಮ್ಮ ಬೆಟ್ಟ ದೊಡೆಯನ
    ಧ್ಯಾನಕೆ ಸರಿಯುಂಟೆ ಪುರಂದರ ವಿಠಲನ ||


  482. Posted by lakshmi baharthi on November 14, 2012 at 8:20 pm

    sorry forgot to mention this is in kannada — of earlier posted song


  483. Posted by Ranjini on November 16, 2012 at 1:17 am

    This site is really Very informative…… please can anyone provide me the lyrics of the song “Sevakanelo naanu ninnaya paada seve needelo neenu” in Kannada?


    • Posted by lakshmi baharthi on November 16, 2012 at 3:50 pm

      ಬಾರೋ ಗುರು ರಾಘವೇಂದ್ರ ಬಾರಯ್ಯ ಬಾ ಬಾ
      ಹಿಂದು ಮುಂದೆಲ್ -ಲೆನಗೆ ನೀ -ಗತಿ
      ಎಂದು ಪೊಂದಿದೆ ನಿನ್ನ ಪಾದವ
      ಬಂಧನವ ಬಿಡಿಸೆನ್ನ ಕರಪಿಡಿ
      ನಂದ ಕಂಡ ಮುಕುಂದ ಬಂಧೋ

      ಸೇವಕನೆಲೋ ನಾನು ನಿನ್ನಯ ಪಾದ
      ಸೇವೆನೀಡೆಲೋ ನೀನು
      ಸೇವಕನ ಸೇವೆಯನು ಸೇವಿಸಿ
      ಸೇವ್ಯ ಸೇವ್ಯಕ ಭಾವ ವೀಯುತ
      ಧಾವಿಸೇನ್ನನು ಪೊರೆಯೋ ಧರೆಯೊಳು
      ಪವನಾತ್ಮಕ ಕಾಯೋ ಕರುಣಿಸಿ

      ಕರೆದರೆ ಬರುವೀಯೆಂದು ಸಾರುವುದು ಡಂಗೂರ
      ತ್ವರಿತಡಿ ಒದಗೋ ಬಂದೂ
      ಜರೆಯು ವ್ಯಾಧಿಯು ಬಾರದೆ ನಿನ್ನ
      ವಿರಹ ತಾಳದೆ ಪಾದಕೆ ಎರಗುವೆ
      ಹರಿಯ ಸ್ಮರೆಣೆಯ ನೀಡುತೆನಗೆ
      ಹರುಷದಲಿ ನೀ ನಿರುತ ಕೊಡುತಲಿ

      ನರಹರಿ ಪ್ರಿಯನೇ ನೀ ಬಾ ಗುರು ಶ್ರೀಶ ವಿಠಲನ
      ಕರುಣಾ ಪಾತ್ರನೆ ಬೇಗ ಬಾ
      ಗುರುವರನೆ ನೀ ಪರಿತೋಷಿಸೇನ್ನನು
      ಮರೆಯದಲೇ ತವ ಚರಣ ಕೋಟೆಯ
      ಲಿರಿಸಿ ಚರಣಾಂಬುಜವ ತೋರುತ
      ತ್ವರಿತದಲಿ ಓಡೋಡಿ ಬಾ ಬಾ


  484. Posted by bhavana on November 17, 2012 at 8:15 am

    There is another song starting with the words “Sevakanelo naanu”
    Ranjini may be looking for that.


  485. Posted by Gayatri on November 18, 2012 at 5:04 pm

    Excellent collection. Thanks for the great work.
    I have been looking for lyrics and audio of these arathi songs that my grandma used to sing: They have these lyrics – don’t have much to go on:
    One : – Indira Kanthanige Indira Rakshanige

    and the other:

    Vigneswara Siddhidhayanige vidhyavanala Koduvanige

    Not sure how easily available they are but if you have heard of them can you post the lyrics and guide me on where I can find audio,




  486. Posted by shiva prakash on December 2, 2012 at 7:14 am

    can someone write english translation of the song written by Jagannatha Dasaru on raghavendra swami:

    rAghavEndra yati sArvabhauma duritaugha dUra tE namO namO
    mAgadharIpumata sAgara mIna mahAgha vinAshana namO namO

    full lyrics is at


  487. Posted by Lakshman on December 16, 2012 at 2:48 pm

    rAghavEndra yati. rAgA: dhanyAsi/bilAval. Adi/kaharvA tALA.

    P: rAghavEndra yati sArvabhauma duritaugha dUra tE namO namO
    mAgadharIpumata sAgara mIna mahAgha vinAshana namO namO
    A: shlAgita guNagaNa sUri prasanga sadAgamajna tE namO namO
    mEgha shyAmala rAmArAdaka mOgha bOdha tE namO namO
    C1: tungabhadra sutarangiNi tIraga mangaLa carita shubhAnga namO
    ingitajna kALinga mardhana yadupungava hrdaya turanga namO
    sangira cihnita shrngArAnana tingaLa karuNApAnga namO
    gAngEya sama bhAnga kumata mAtanga sangha citapinga namO
    2: kOvida mastaka shObhita maNI smbhAvita mahima pAlayamAm
    sEvApara sarvArthaprada brndAvana mandira pAlayamAm
    bhAvaja mArgaNa bhujaga vinAyaka bhAvajna priya pAlaya mAm
    kEvala nutajana pAvana rUpa sadA vinOdi hE pAlaya mAm
    3: shrI sudhIndra karajAta namO namO bhUsura vinuta vikhyAta namO namO
    dEshika vara samsEvya namO namO dOSa vivarjita kAvya namO
    klEshita jana paripala namO namO bhUSita karuNA shIla namO
    vyAsarAya pada bhakta namO namO shAsvata dharmAsakta namO
    4: sannuta mahima shrI jagannAtha viThala sahnita mAnasa jaya jaya bhO
    cihnita daNDa kamaNDala puNDra prapanna bhayApaha jaya jaya bhO
    mAnya mahAtma prasanna vadana kAruNyapayOnidhi jaya jaya bhO
    dhanya kSEma sampannadharAmara sharaNya sadArthita jaya jaya bhO


  488. Posted by Deepa Shenoy on December 24, 2012 at 5:53 am

    Pls can anyone send the lyrics of ‘O yennuva ganapa karedaaga,o yennuva ganapa’… in english or kannada…


  489. Posted by Chaitra on December 29, 2012 at 6:27 am

    can you plz post the lyrics of the song dimbadalliruva jeeva kamba sutra bombeyante


    • ರಚನೆ : ಶ್ರೀ ಕನಕ ದಾಸರು

      ದಿಂಬದಲ್ಲಿರುವ ಜೀವ ಕಂಬ ಸೂತ್ರ ಗೊಂಬೆಯಂತೆ,
      ಎಂದಿಗಾದರೊಂದು ದಿನ ಸಾವು ತಪ್ಪದ್ದೊ ,
      ಎಂದಿಗಾದರೊಂದು ದಿನ ಸಾವು ತಪ್ಪದ್ದೊ

      ಹುಟ್ಟುತ್ತೇನೆ ತರಲಿಲ್ಲ ,ಸಾಯುತೇನು ಒಯ್ಯಲಿಲ್ಲ
      ಸುಟ್ಟು ಸುಟ್ಟು ಸುಣ್ಣದಗಳು ಆಯಿತೀ ದೇಹ.
      ಹೊಟ್ಟೆ ಬಲು ಕೆಟ್ಟದೆಂದು ಎಷ್ಟು ಕಷ್ಟ ಮಾಡಿದರು
      ಬಿಟ್ಟು ಹೋಗುವಾಗ ಗೇಣು ಬಟ್ಟೆ ಕಾಣರೋ

      ಹತ್ತು ಎಂಟು ಲಕ್ಷ ಗಳಿಸಿ ಮತ್ತೆ ಸಾಲದೆಂದು
      ಪರರ ಅರ್ಥಕ್ಕಾಗಿ ಆಸೆ ಪಟ್ಟು ನ್ಯಾಯ ಮಾಡ್ವರೋ
      ಬಿಟ್ಟಿ ಬೆಳೆಸು ತನ್ನದೆಂದು ವ್ಯರ್ಥ ಚಿಂತೆಯನ್ನು ಮಾಡಿ
      ಸತ್ತು ಹೋದ ಮೇಲೆ ಅರ್ಥ ಯಾರಿಗಾಗುದೋ.

      ಹೆಣ್ಣು ಹೊನ್ನು ಮಣ್ಣು ಮೂರು ತನ್ನಲಿದ್ದೂ ಉಣ್ಣಲಿಲ್ಲ
      ಅಣ್ಣ ತಮ್ಮ ತಾಯಿ ತಂದೆ ಬಯಸಲಾಗದೊ
      ಅಣ್ಣ ವಸ್ತ್ರ ಭೋಗಕ್ಕಾಗಿ ತನ್ನ ಸುಖವ ಕಾಣಲಿಲ್ಲ
      ಮಣ್ಣು ಪಾಲು ಆದ ಮೇಲೆ ಯಾರಿಗಾಗುದೋ

      ಬೆಳ್ಳಿ ಬಂಗಾರಿಟ್ತುಕೊಂಡು ಒಳ್ಳೇ ವಸ್ತ್ರ ಹೊದ್ದುಕೊಂಡು
      ಚಳ್ಳ್ ಪಿಳ್ಳ್ ಗೊಂಬೆಯಂತೆ ಆಗಿ ಹೋದೆನೇ
      ಹಳ್ಳ ಹರಿದು ಹೋಗುವಾಗ ಗುಳ್ಳೆ ಬಂದು ಒಡೆಯುವಂತೆ
      ಗುಳ್ಳೆ ಪೊರೆಯಂತೆ ಕಾಣೊ ಸಂಸಾರದಾಟ

      ವಾರ್ತೆ ಕೀರ್ತಿ ಎಂಬೋ ಎರಡು ಸತ್ತ ಮೇಲೆ ಬಂದವಯ್ಯ
      ವಸ್ತು ಪ್ರಾಣ ನಾಯಕನು ಹ್ಯಾಂಗೆ ದೊರಕುವನೋ
      ಕರ್ತೃ ಕಾಗಿನೆಲೆಯಾದಿ ಕೇಶವನ ಚರಣ ಕಮಲ
      ನಿತ್ಯದಲಿ ಭಜಿಸಿ ಸುಖೀಯಾಗಿ ಬಾಳೇಲೋ
      ಸುಖೀಯಾಗಿ ಬಾಳೇಲೋ


  490. Posted by sujatha on January 8, 2013 at 8:48 am

    i want ondhu kaladhalli ughabhoga


    • Posted by bhavana on January 8, 2013 at 11:23 am

      ಒಂದು ಕಾಲದಲ್ಲಿ ಆನೆ ಕುದುರೆ ಮೇಲ್ಮೆರೆಸುವೆ
      ಒಂದು ಕಾಲದಲ್ಲಿ ಬರಿಗಾಲಲ್ಲಿ ನಡೆಸುವೆ
      ಒಂದು ಕಾಲದಲ್ಲಿ ಮೃಷ್ಟಾನ್ನವುಣಿಸುವೆ
      ಒಂದು ಕಾಲದಲ್ಲಿ ಉಪವಾಸವಿರಿಸುವೆ
      ನಿನ್ನ ಮಹಿಮೆಯ ನೀನೆ ಬಲ್ಲೆಯೊ ದೇವ
      ಪನ್ನಗಶಯನ ಶ್ರೀ ಪುರಂದರವಿಠಲ
      oMdu kaaladalli aane kudure mElmeresuve
      oMdu kaaladalli barigaalalli naDesuve
      oMdu kaaladalli mRuShTaannavuNisuve
      oMdu kaaladalli upavaasavirisuve
      ninna mahimeya nIne balleyo dEva
      pannagashayana shrI puraMdaraviThala


  491. Posted by sujatha on January 8, 2013 at 8:50 am

    i want udupiya kandeera composer


  492. Posted by jamuna on January 10, 2013 at 4:24 pm

    I just happened to stumble onto this website and see that Ms. Meera has a wealth of informtion re lyrics of old and not so frequently heard songs. I am looking for the lyrics of a song sung by my grandmother who of course is not here anymore.
    the few words i know are:
    Hari pada gala nitya neneyu adare…somthing)(
    parama paratpare saakshi;
    then it goes on to say:
    anna daanava maadida manujage
    akshya paatravu saakshi

    and then another verse started with:
    kanya daanava maadida manujage……
    If by any chance you would know this song… iwill be very grateful. thank you very much.


  493. Posted by Lakshman on January 11, 2013 at 8:40 am

    hari krpeyali tAnoliddAdare. rAgA: dhanyAsi. Adi tALA. Purandaradasa.

    P: hari krpeyali tAnoliddAdare urutara mOkSave sAkSi
    A: hari sharaNara sEvisuva nararige dhareya saukhyave sAkSi
    C1: maDadi makkaLa sAgade biDuvage kaDu dAridryave sAkSi
    kaDu baDavage dharmava koDadire bAyi biDuvade pararige sAkSi
    2: anna dAnava mADidavage divya anna umbuvade sAkSi
    honnu dAnava mAdadavage para dainya baDuvude sAkSi
    3: kanyA dAnava mADidavage divya heNNina bhOgavE sAkSi
    kanyA dAnava mADadavge heNNina hOrATave sAkSi
    4: kaNDa puruSage kaNNikkuvaLige gaNDana kaLevude sAkSi
    bhaNTatanadi para strIyara meccuvage heNDira kaLevude sAkSi
    5: kSEtra dnava mADidavage Eka chatra rAjyave sAkSi
    pAtrApAtravanaridu dAna mADidavage putrara paDevude sAkSi
    6: paripari tAnuNDu parari kondikkada narage gulma rOgave sAkSi
    paripariyindali hiriyara dUSise tiridumbOde balu sAkSi
    7: bhaktiyillada adhamarigondu kattale maneya sAkSi
    mukti paDevudake shrI purandara viTTalana bhaktanAgiruvude sAkSi


  494. Posted by Ranjini on January 14, 2013 at 3:01 am

    Pls provide the lyrics of the song “Are Ghaligeyu ninna smarane bidenu shri Raghavendra Karuna Saandra” and also please please provide lyrics of “Sevakanelo Naanu” if you get………… Thanks in advance madam.


  495. Posted by Ranjini on January 15, 2013 at 5:53 am

    since the song goes fast in the charanam i dint get the lyrics of sevakanelo naanu song……….. thanks for the audio.. please provide the lyrics if you get……….


  496. Posted by Lakshman on January 17, 2013 at 11:28 am

    Here is my best attempt. Corrections welcome.

    sEvakanelo nAnu. rAgA: madhyamAvati. rUpaka tALA. Vadirajasvami.

    P: sEvakanelo nAnu ninnaya pAda sEveniDelo nInu
    A: sEvekanelo nAnu tEdeniDelO nInu kAvudEnelo shrI vadhUvara rAvaNAntaka rakSitennanu
    gOvardhanadhara dEva hOvugaLa kAva shrI mananubhAva varagaLa nIva dEvA
    shrI vallabha dayamADennoLu IvELage indirA ramaNa
    C1: rAma dasharatha nandanA raghukulAmbudhi sOmasundara vadana
    vAma paripurNa kAma kausalyA rAma svAmi shrI rangadhAma daitya virAma shrI madanantanAma
    shrIman munijana stOma ramyaguNa dhAma raNaranga bhIma kOmala shyAma rAmA
    sAmajavaradAnanda nidhi kAmaita phala karunidhi kAyO
    2: shankara sura sEvitA shESa garuDAlankAra maNI bhUSitA
    pankajasana nayana ninAbnka janaka pAda pankAjAsana vinuta tirupati venkaTa dirdAnaka jaya jaya
    shankhA shankha cakradhari pankajadhara akaLanka carita ATanka olida nisshankhA
    lankAdhipa lAlita raghupati kinkArike kinkari nAnenu
    3: mandaharadhara mAdhavA madhusUdanAnanda sundara viThalA
    indu mAdhava gOvinda gOkulAnada sangitAmara brnda vEdava tanda turagavanEri banda
    brndAvanadoLaginda yashOdeya kanda harigOvinda shESagiriyalininda
    mandAkini draupadi dhruvapari nandaniyenapari hayavadana


  497. Posted by divya v.n on January 19, 2013 at 4:11 am


    this website is really good and having lot of good songs, slokas, thanks for your efforts.


  498. Dear Mira,
    Can you give lyrics for ” Narasimha Deva Nembo” song. I am waiting for it since long. Much obliged if you give.Thanq.


    • Posted by meeraghu on January 27, 2013 at 9:09 am

      It is Meera and not Mira. Also, the lyrics for that have been long posted, please check the lyrics page.


  499. Posted by Sreehari.P. on February 2, 2013 at 3:55 pm

    Dear Ms. Meera,

    Please provide me your mail id here or mail me at I am trying to collect some details and scriptures all together with daasa sahitya and other many documents. May be I could be of help to you.

    You can expect the documents very shortly. 🙂


  500. Posted by krishna on February 8, 2013 at 4:32 am

    HI can i get the lyrics of the stotram.
    Also what is the name of the stotram.
    “Ohm hara poorvika devi veena pusthaka tharini veda matha namasthubyam”


  501. hi meera…
    ur blog is amazing i have tried food corner also…. i would like to tell u that while surfing on net for lyrics i got site with name AARSHVANI… many well known bhajans are available with lyrics meaning in hindi english kannada and tamil too… u must see that site… and gr8 job and all the very best….. keep it up


  502. Posted by Chaitra on February 13, 2013 at 7:14 am

    can i get the lurics of the song shrungapuradishvari sharade


  503. Posted by Chaitra on February 13, 2013 at 7:45 am

    namaste madam..

    can i please know where i can here the song saari bandane pranesha bandane….


  504. Posted by Lakshman on February 13, 2013 at 9:04 am

    shrngapurAdhIshvari. rAgA: kalyANi. Adi tALA. Composer: A.V.Krishnamachar. (Padmacharan)

    P: shrngapurAdhIshvarI shAradE shubha mangaLE sarvAbhISTapradE
    A: shankara sannuta shrIpadmacaraNE sakalakalA
    vishAradE varadE salahenna tAye sAmagAnapriyE
    C: karuNisemma shruti gatigaLa mAtE kamanIya sapta svara supUjitE
    kAvyagAna kalA svarUpiNi kAmita dAyini kalyANi jananI


  505. Posted by sujatha on February 14, 2013 at 6:52 pm

    is very good , is this dasara padagalu


  506. Posted by kishore on February 23, 2013 at 11:54 am

    do any one have the album “Haridasa Nada SAurabha ” sung by sindhura moorthy?
    pl share


  507. Posted by Pravina N kamath on March 7, 2013 at 3:41 am

    can i get the lyrics of songs 1. vrindavanave mandiravagide 2.jaganmohanane krishna in kannda.
    i am waiting for your reply.


    • ಬೃಂದಾವನವೇ ಮಂದಿರವಾಗಿದೆ ಇಂದಿರೆ ಶ್ರೀ ತುಳಸಿ|ಪ|
      ನಂದ ನಂದನ ಮುಕುಂದಗೆ ಪ್ರಿಯಳಾದ ಚಂದದ ಶ್ರೀ ತುಳಸಿ |ಅ.ಪ|

      ತುಳಸಿಯ ವನದಲಿ ಹರಿ ಇಹನೆಂಬುದ ಶೃತಿ ಸಾರುತಿದೆ ಕೇಳಿ
      ತುಳಸಿ ದರ್ಶನದಿಂದ ದುರಿತಗಳೆಲ್ಲವು ದೂರವಾಗುವುದು ಕೇಳಿ
      ತುಳಸಿ ಸ್ಪರ್ಶವ ಮಾಡೇ, ದೇಹಪಾವನವೆಂದು ತಿಳಿಯುದಿಲ್ಲವೇ ಕೇಳಿ
      ತುಳಸಿ ಸ್ಮರಣೆ ಮಾಡಿ ಸಕಲ ಇಷ್ಟವಪಡೆದು ಸುಖದಲಿ ನೀವು ಬಾಳಿ |೧|

      ಮೂಲ ಮೃತ್ತಿಕೆಯನು ಮುಖದಲಿ ಧರಿಸಲು ಮೂರ್ಲೋಕ ವಶವಹುದು
      ಮಾಲೆ ಕೊರಳಲಿಟ್ಟ ಮನುಜಗೆ ಮುಕುತಿಯ ಮಾರ್ಗವ ತೋರುವುದು
      ಕಾಲ ಕಾಲಗಳಲಿ ಮಾಡಿದ ದುಷ್ಕರ್ಮ ಕಳೆದು ಬಿಸಾಡುವದು
      ಕಾಲನ ದೂತರ ಕಳಚಿ ಕೈವಲ್ಯದ ಲೀಲೆಯ ತೋರುವುದು |೨|

      ಧರೆಯೊಳು ಮರೆಯದೇ ಸುಜನರ ಸಲಹುವ ವರಲಕ್ಷ್ಮೀ ಶ್ರೀ ತುಳಸಿ
      ಪರಮ ಭಕ್ತರ ಘೋರ ಪಾಪಗಳ ತರಿದು ಪಾವನ ಮಾಡುವ ತುಳಸಿ
      ಸಿರೀಯಾಯುಪುತ್ರಾದಿ ಸಂಫಲಗಳನಿತ್ತು ಹರುಷಗೊಳಿಪ ತುಳಸಿ
      ಪುರಂದರ ವಿಠಲನ ಚರಣ ಕಮಲಗಳ ಸ್ಮರಣೆಕೊಡುವ ತುಳಸಿ|೩|

      You will find the lyrics for .jaganmohanane krishna here.

      I would like to thank Shree Lakshman.Keep the good work going.If you have any books / source for Daasara padagalu or Daasa Saahitya please let me know.Thank You Again.

      Shree Krishnarpanamastu.
      Dev Bare Karo.


      • Posted by pravina n kamath on March 7, 2013 at 11:58 am

        thank you for your reply do post more lyrics if you have

      • Posted by Bhavana on November 6, 2013 at 6:45 am

        Dear neel pai,

        Please give audio link for ಬೃಂದಾವನವೇ ಮಂದಿರವಾಗಿದೆ ಇಂದಿರೆ ಶ್ರೀ ತುಳಸಿ|

  508. Posted by Lakshman on March 7, 2013 at 9:15 am

    jaganmOhananE. rAgA: behAg/SaNmukhapriyA. Adi tALA. Purandaradasa.

    P: jaganmOhananE krSNa krSNa jagava pAlipanE krSNa
    C1: ondu pAdava bhUmiyalUri mattondu pAdava gaganavanaLedu
    ondupAda bali rSiradale iTTe inthA vidyavanelli kaliteyO ranga?
    2: lOkadoLage nI shishuvAgi mUru lOkavanella bAyalli tOride
    AkaLa kAyuva chiNNanemdeniside I kuTilavanella elli kaliteyO ranga
    3: endendigu nimma guNagaLannu pogaLalu indrAdigaLige aLavalla
    mandharadhara shrI purandara viTTalanE ondondATavanelli kaliteyO ranga

    vrndAvanavE mandiravAgiha. rAgA: saurASTra. aTa tALA. Purandaradasa.

    P: vrndvanavanavE mandiravAgiha indire shrI tulasi
    A: namma nandana mukundage priyavAda cendAda shrI tulasi
    C1: tulasi vanadalli ihanembOdu shruti sArutide kELi tulasi darshanadinda duritagaLella haridu hOgOdu kELi
    tulasi sparsahanadinda dEha pAvanavendu nIvella tiLidu kELi tulasi smaraNe mADi sakaliSTava baDedu sukhadali nIvu bALi
    2: mUla mrttikeyanu dharisida mATradi mUru lOka vahavAhudu mAlegaLane koraLalliTTa manujake mukti mArgava nIvudu
    kAla kAlagaLali mADida duSkarma kaLedu bisuTu hOgOdu kAlana dUtara aTTi kaivalyava lIleya tOruvudu
    3: dhareyoLu su-janara mareyade salahuva vara lakSmI shrI tulasi parama bhaktara pApagaLella taridu pAvana mADuvaLu tulasi
    siri Ayu putrAdi sampattugaLanittu haruSavIvaLu tulasi purandara viTTalanna smaraNe koDuvaLu tulasi


  509. Posted by Lakshman on March 7, 2013 at 12:19 pm

    Neel Pai: Please contact me at so that I can give you more details about books.


  510. Posted by Alaka on March 15, 2013 at 6:09 am

    Hi, Can somebody post the lyrics for “hakkiya hegaleri bandagave”



  511. Posted by Lakshman on March 15, 2013 at 7:52 am

    hakkiya hegalEri. rAgA : kannaDakAnbOji. Adi tALA. Prasannavenkatadasa.

    P: hakkiya hegalEri bandavage nODakka manasOte naanavage
    C1: satraajitana magaLettida unmatta narakadoLu kAdida
    matte keDahida avanangava satigittanu tA Alinganava
    2: hadinAru sAvira nAriyara sere mudadinda biDisi manOhara
    aditiya kuNDala kaLisida hari vidhisuranruparanu saluhida
    3: uttama prAgjOtiSapurava bhagadattage koTTa varAbhayava
    karta kruSNayyana nambide shrI mUrtiya pAdava hondide
    4: naraka caturdashi parvada dina haruSadi prakaTAdanu dEva
    sharaNAgatajana vatsalaa ranga parama bhAgavatara paripAla
    5: hogaLi kruSNayyana mahimeya mukti nagarada arasana kIrtiyA
    jagadIsha prasanvEnkaTEshanu bhaktaraghahAri ravikOTi prakAshanu


  512. Posted by Usha on March 27, 2013 at 12:43 am

    Hi Meera… I am looking for Prahalada Charithre in Kannada… Do you have the same?


  513. Posted by Gopal on May 17, 2013 at 6:01 am

    I am looking for Mrunthunjaya stotra if u have pls


  514. Posted by Lakshmi on May 17, 2013 at 5:37 pm

    These are two places that it is in english

    ಮಹಾ ಮೄತ್ಯುಂಜಯ ಸ್ರ‍ೋತ್ರಂ

    ಓಂ ಅಸ್ಯ ಶ್ರೀ ಮಹಾ ಮೃತ್ಯುಂಜಯ ಸ್ತೋತ್ರ ಮಂತ್ರಸ್ಯ

    ಶ್ರೀ ಮಾರ್ಕಾಂಡೇಯ ಋಷಿಃ ಅನುಷ್ಟುಪ್ ಛಂದಃ

    ಶ್ರೀ ಮೃತ್ಯುಂಜಯೋ ದೇವತಾ ಗೌರೀಶಕ್ತಿಃ ಮಮ ಸರ್ವಾರಿಷ್ಟ

    ಸಮಸ್ತ ಮೃತ್ತ್ಯುಶಾಂತ್ಯರ್ಥಂ ಸಕಲೈಶ್ವರ್ಯ ಪ್ರಾಪ್ತ್ಯರ್ಥಂ

    ಜಪೇ ವಿನಿಯೋಗಃ ಅಥ ಧ್ಯಾನಮ್

    ಚಂದ್ರರ್ಕಾಗ್ನಿವಿಲೋಚನಂ ಸ್ಮಿತಮುಖಂ ಪದ್ಮದ್ವಯಾಂತಃ ಸ್ಥಿತಮ್’

    ಮುದ್ರಾಪಾಶ ಮೃಗಾಕ್ಷ ಸತ್ರವಿಲಸತ್ ಪಾಣಿಂ ಹಿಮಾಂಶುಂ ಪ್ರಭುಮ್

    ಕೋಟೀಂದು ಪ್ರಹರತ್ ಸುಧಾಪ್ಲುತ ತನುಂ ಹಾರಾದಿಭೊಷೋಜ್ವಲಂ

    ಕಾಂತಂ ವಿಶ್ವವಿಮೋಹನಂ ಪಶುಪತಿಂ ಮೃತ್ಯುಂಜಯಂ ಭಾವಯೇತ್

    ಓಂ ರುದ್ರಂ ಪಶುಪತಿಂ ಸ್ಧಾಣುಂ ನೀಲಕಂಠಂಮುಮಾಪತಿಮ್

    ನಮಾಮಿ ಶಿರಸಾದೇವಂ ಕಿಂ ನೋ ಮೃತ್ಯುಃ ಕರಿಷ್ಯತಿ

    ನೀಲಕಂಠಂ ಕಾಲಮೂರ್ತಿಂ ಕಾಲಜ್ಞಂ ಕಾಲನಾಶನಂ

    ನಮಾಮಿ ಶಿರಸಾ ದೇವಂ

    ನೀಲಕಂಠಂ ವಿರೂಪಾಕ್ಷಂ ನಿರ್ಮಲಂ ನಿಲಯಪ್ರಭವ್

    ನಮಾಮಿ ಶಿರಸಾ ದೇವಂ

    ವಾಮದೇವಂ ಮಹಾದೇವಂ ಲೋಕನಾಥಂ ಜಗದ್ಗುರುಂ

    ನಮಾಮಿ ಶಿರಸಾ ದೇವಂ

    ದೇವದೇವಂ ಜಗನ್ನಾಥಂ ದೇವೇಶಂ ವೃಷಭಧ್ವಜಮ್

    ನಮಾಮಿ ಶಿರಸಾ ದೇವಂ

    ಗಂಗಾಧರ‍ಂ ಮಹಾದೇವಂ ಸರ್ವಾಭರಣಭೂಷಿತಮ್

    ನಮಾಮಿ ಶಿರಸಾ ದೇವಂ

    ಅನಾಥಂ ಪರಮಾನಂದಂ ಕೈವಲ್ಯಪದಗಾಮಿನಂ

    ನಮಾಮಿ ಶಿರಸಾ ದೇವಂ ಕಿಂ

    ಸ್ವರ್ಗಾಪವರ್ಗದಾತಾರಂ ಸೃಷ್ಟಿಸ್ಥಿತಿ ವಿನಾಶಕಮ್

    ನಮಾಮಿ ಶಿರಸಾ ದೇವಂ ಕಿಂ

    ಉತ್ವತ್ತಿಸ್ಥಿತಿಸಂಹಾರ ಕರ್ತಾರಮೀಶ್ವರಂ-ಗುರುಮ್

    ನಮಾಮಿ ಶಿರಸಾ ದೇವಂ ಕಿಂ

    ಮರ್ಕಂಡೇಯ ಕೃತಂ ಸ್ತೋತ್ರಂ ಯಃ ಪಠೇತ್ ಶಿವಸನ್ನಿಧೌ

    ತಸ್ಯ ಮೃತ್ಯುಭಯಂ ನಾಸ್ತಿನಾಗ್ನಿ ಚೋರಭಯಾತ್ ಕ್ವಚಿತ್

    ಶತಾವರ್ತಂ ಪ್ರಕರ್ತವ್ಯಂ ಸಂಕಟೇ ಕಷ್ಟನಾಶನಮ್

    ಶುಚಿರ್ಭೋತ್ವಾ ಪಠೇತ್ ಸ್ತೋತ್ರಂ ಸರ್ವಸಿದ್ಡಿ ಪ್ರದಾಯಕಮ್

    ಮೃತ್ಯುಂಜಯ ಮಹಾದೇವ ತ್ರಾಹಿಮಾಂ-ಶರಣಾಗತಮ್

    ಜನ್ಮ ಮೃತ್ಯು ಜರಾರೋಗೈಃ ಪೀಡಿತಂ ಕರ್ಮಬಂಧನೈಃ

    ತಾವಕಸ್ತ್ವದ್ಗತಪ್ರಾಣಸ್ವಚ್ಛಿತ್ತೋಹಂ ಸದಾಮೃಡ

    ಇತಿ ವಿಜ್ಜಾಪ್ಯ ದೇವೇಶಂ ತ್ರ್ಯಂಬಕಾಖ್ಯಂ ಮನುಂ ಜಪೇತ್

    ನಮಃ ಶಿವಾಯ ಸಾಂಬಾಯ ಹರಯೇ- ಪರಮಾತ್ಮನೇ-

    ಪ್ರಣತಕ್ಲೇಶ ನಾಶಾಯ ಯೋಗಿನಾಂ ಪತಯೇ ನಮಃ

    ಇತಿ ಮಹಾಮೃತ್ಯುಂಜಯ ಸ್ತೋತ್ರಂ


  515. Posted by Gopal on May 19, 2013 at 10:30 pm

    Thanku Lakshmi!!!! Thanks a lot for your valuable reply..,


  516. Posted by manjula on June 3, 2013 at 7:56 pm

    Dear Mira,
    Can you get me the lyrics of The song starting like this, ” Ninnangri Bideno Srinivasa “. It will end with ankithanama like this, Prasanna venkatadri Srinivasa”. Thanks a lot if you or any of our friends help me.


  517. Posted by Lakshman on June 4, 2013 at 7:00 am

    biDano ninnamghri. rAgA: ? no given tALA. Prasannavenkatadasa.

    P: biDano ninnanghri shrInivAsA enna duDisikolLelo shrInivAsA
    C1: ninna nuDiya jItallo shrInivAsA enna naDetappu kAyo shrInivAsA
    baDiyo bennali shrInivAsA nannoDala hoyyadiro shrInivAsA
    2: nA baDava kANelo shrInivAsA ninnoDala hokkeno shrInivAsA
    panjuviDiveno shrInivAsA ninnenjala baLidumbe shrInivAsA
    3: nA sanjI udayake shrInivAsA kALanjeya piDive shrInivAsA
    sattige cAmara shrInivAsA nAnetti kuNivEnO shrInivAsA
    4: ninna rattnada hAvige shrInivAsA nA hottu naliveno shrInivAsA
    hILidantAlipee shrInivAsA ninnALigALAgihI shrInivAsA
    5: avaruuLigava mAlpE shrInivAsA nanna pAlisO biDadE shrInivAsA
    ninna nAma hULigE shrInivAsA kalLa kunni nAnAgihE shrInivAsA
    6: kaTTi ninnavarOddarE shrInivAsA nanaginnu lajjEtakE shrInivAsA
    bIsi kOllalavarE shrInivAsA mudrE kAsi cuccalavarE shrInivAsA
    7: mikka ghAsiganjEnayya shrInivAsA enjalAsEya banTa nA shrInivAsA
    hEsi nAnAdarE shrInivAsA hari dAsaroLu pOkkE shrInivAsA
    8: avara bhASE kELihE shrInivAsA AvAsiya sairisO shrInivAsA
    tingalavanalla shrInivAsA vatsarangalavanalla shrInivAsA
    9: rAjangaLa savaDipE shrInivAsA bhavangaLa dATuvE shrInivAsA
    ninnava ninnava shrInivAsA nAnanyavanariyEnu shrInivAsA
    ayyA mannisO tAytandE shrInivAsA prasannavEnkaTAdri shrInivAsA


  518. Posted by PADMA on June 10, 2013 at 12:20 am

    Hi, do you have the lyrics in devanagiri for Taye Yashoda


  519. Posted by Ranjini on June 13, 2013 at 11:31 am

    madam please post guru guna stavana by Sri Vadeendra tirtharu lyrics and meaning in Kannada…


    • Posted by Ranjini on June 20, 2013 at 10:02 am

      thank u very much….. plz post kannada meaning of guruguna stavana if u have…… thanks in advance.


  520. Posted by Lakshman on June 14, 2013 at 5:45 am

    There are seven caraNAs for tAyE yashOdE. I have transliterated four. I will post the other three later. Only the first caraNa is usually sung.

    प: ताये यशोदे उन्दन आयर कुलत्तुदित्त मायन गोपालकृष्णन सोल्लुम जालत्तै केळडि
    अ: तय्यले केळडि उन्दन पय्यनै पोलावे इन्द वैयगत्तिल ओरु फिळ्ळै अम्मम्मा नान कण्डदिल्लै
    च१: कलील सिलम्बु क्नोज कै वळै कुलुङ्ग मुत्तु मालैगळ अशैय तेरु वासलिल वन्दान कालाशैयुम कैयाशैयुम ताळमोडु इसैंदु वर नील वण्ण कण्णन इवन नर्तनं आडिनान बालन एन्रु तवि अणैत्तेन अणैत्त एन्नै मालैयिट्टवन पोल वायिल मुत्तमिट्टाण्डि बालन अल्लादी उन मगन जालम मिग सेय्युम कृष्णन नालु पेर्गळ केट्क सोल्ल नणम मिगवागुदडि
    २: अनरोरु नाळ इन्द वज्ही वन्द विरुन्दिरुवम अयर्न्दु पदुततुरंगुम पोदिनिले कण्णन तिनरदु पोग कैयिल इरुन्द वेण्णैयै अन्द विरुन्दिनर वायिल निरैत्तु मरैन्दनने अन्द निन्दै मिगु नोन्दिडवुम सेय्य तगुमो नंदा गोपर्क्किन्द इन्द मिगु पिळ्ळै पेर नल्ल तवं सेइदारडि नाङ्गळ एन्न सेइमोमडि
    ३: एङ्गळ मनै वाश्ह वन्द ननगैयैत्तन्नम तनियाइ तुंगा यमुना नदिप्पोइगैयिले कण्णन सलंगैयुम इल्लादपडि पनगैयक्कण्णाल मयक्कि एङ्गेङ्गो अज्हैत्तु सेंरू निशि वन्दान उन मगन नान एनरान सोल्ली निंर पिन तडै इनरी वेण्णैत्तारुम एनरान
    ४: तोट्टिलिनिले पिळ्ळै किळॢ विट्टदुम अवन अलर विट्ट मट्टिलात्तुम्बै कज्हुत्तिल माट्टिक्कोण्डान विट्टु विट्टु अम्मे एनरान कन्रिनैप्पोले अट्टियिल्लाद माडुम अम्मा एन्रदे किट्टिन कुवळैयोडुम एट्टिनाल उन सेल्व मगळ पट्टियिल करवैयिडम पालै ऊट्टुरानडि


  521. i wants bhakti songs nanena madideno rangayya ranga ni yena kaya bekho


  522. ನಿನ್ನ ಅಂಗಳದೊಳಗೆ ಹಿಡಿ ಅನ್ನ ಹಾಕೋ

    ನಿನ್ನ ಅಂಗಳದೊಳಗೆ ಹಿಡಿ ಅನ್ನ ಹಾಕೋ ಘನ್ನ ಶ್ರೀಗುರುರಾಘವೇಂದ್ರ ಸಂಪನ್ನ || ಪಲ್ಲವಿ||

    ವರುಷ ವರುಷಕೆ ನಿನ್ನ ದರುಶನವ ದಯಮಾಡೋ | ದುರಿತ ನಾಶಗೈದು ಪರಿಶುದ್ಢಗೊಳಿಸೋ |
    ಅರಿತು ಅರಿಯದೆ ಗೈವ ಪಾಪಕರ್ಮವ ಕಳೆದು | ನಿರುತ ಶ್ರೀಹರಿ ಕೃಪೆಗೆ ಪಾತ್ರನಾಗಿರಿಸೋ || ೧||

    ನಿನ್ನ ಭಕುತರ ಪಾದ ರಜದೊಳೀಡಾಡಿಸೋ | ನಿನ್ನ ಗುಣಕೀರ್ತನೆಯ ಕಿವಿಗಳಲಿ ನಿಲಿಸೋ |
    ನಿನ್ನ ಪದೋದಕದಿ ಪಾವನ್ನ ಮಾಡೆನ್ನ | ನಿನ್ನ ರಘುಪತಿ ದಿವ್ಯ ದರುಶನವ ಕೊಡಿಸೋ || ೨||

    ಮಂತ್ರಸದನದಿ ನಿನ್ನ ಸಂತಸ ಮಹೋತ್ಸವದಿ | ಶಾಂತಿಸುಖ ಸಂಭ್ರಮದಿ ಸನ್ನಿಧಿಯೊಳಿರಿಸೋ |
    ಸಂತ ಶರಣರ ಭಕುತಿ ನೃತ್ಯಗೀತೆಗಳು | ನಿಂತು ನಲಿಯುವ ಭಾಗ್ಯ ಕೊಡು ಎನಗೆ ಪ್ರಭುವೇ || ೩||

    ಪ್ರಹ್ಲಾದ ರಾಯ ನೀ ಬಲ್ಲಿದನು ಜಗದೊಳಗೆ | ನಿಲ್ಲದೆ ಕಾಯ್ವ ನರಹರಿ ದೂತನಹುದೋ |
    ಎಲ್ಲ ರಾಜರ ರಾಜ ವ್ಯಾಸರಾಯನೆ ಸತ್ಯ | ಇಲ್ಲಿ ಶ್ರೀ ಪರಿಮಳಾರ್ಯರ ಮಹಿಮೆ ಸ್ತುತ್ಯ|| ೪||

    ಎನು ಬೇಡಲಿ ನಾನು ದಾನಿ ಕರ್ಣನು ನಿನ್ನ | ಜ್ಞಾನಿ ಸದ್ಗುರು ಕಲ್ಪವೃಕ್ಷ ಸುರಧೇನು|
    ದೀನ ರಕ್ಷಕ ವಿಠಲೇಶ ಕರುಣಾಭರಣ | ಸಾನು ರಾಗದಿ ನಿನ್ನ ಸೇವಕರೊಳಿಸೋ || ೫||

    ||ಶ್ರೀಮದ್ಗುರುವಂತರ್ಗತ ಶ್ರೀಭಾರತಿರಮಣ ಮುಖ್ಯಪ್ರಾಣಾಂತರ್ಗತ ಶ್ರೀಕೃಷ್ಣಾರ್ಪಣಮಸ್ತು ||

    ನಾಹಂ ಕರ್ತಾ ಹರಿಃ ಕರ್ತಾ


  523. do you have bhakti songs nanena madideno rangayya ranga ni yena kaya bekho in kannada lyrics,
    pls send urgently


  524. ನಾನೆನು ಮಾಡಿದೆನೊ ರಂಗಯ್ಯಾ ರಂಗಾ ನೀ ಎನ್ನ ಕಾಯಬೇಕೊ
    ಮಾನಾಭಿ ಮಾನವು ನಿನ್ನದುಯೆನಗೆನು ದೀನರಕ್ಷಕ ತಿರುಪತಿಯವೇಂಕಟರಮಣ || ಪ ||

    ರಕ್ಕಸ ಸೂದನನೆ ಕೇಳೋ ಧೃವರಾಯ ಚಿಕ್ಕವನಲ್ಲವೆನೋ
    ಉಕ್ಕಿಬರುವಾ ಕರ್ಮ ಮಾಡಿದ ಅಜಾಮೀಳ ನಿನ್ನಕ್ಕನ ಮಗನೆನೋ || ೧ ||

    ಕರಿರಾಜ ಕರೆಸಿದನೇ ದ್ರೌಪದಿ ದೇವಿ ಬರೆದೊಲೆ ಕಳುಹಿದಳೇ
    ಹರುಷದಿಂದಲಿ ಋಷಿ ಪತ್ನಿಯ ಶಾಪವ ಪರಿಹರಿಸಿದೆಯಲ್ಲೋ || ೨ ||

    ಮುಪ್ಪಿಡಿ ಅವಲಕ್ಕಿಯ ತಂದವನಿಗೆ ಒಪ್ಪುವಂತೆ ಕೊಡಲಿಲ್ಲವೆ
    ಸರ್ಪಶಯನ ಶ್ರೀ ಪುರಂದರ ವಿಠಲ ಅಪ್ರಮೆಯ ಕಾಯೋ || ೩ ||

    ನಾಹಂ ಕರ್ತಾ ಹರಿಃ ಕರ್ತಾ


  525. Haraye Namah,

    I do have Guruguna Stavana Lyrics with meaning in English…uploading here the same…sooon i’ll get kannada version will upload.

    GURUGUNA STAVANA (in English with meaning)

    1st shloka:
    unmeelanneelaneeroruha nivahamahah pushtimushtindhayisrih
    sri bhoodurgaadrubantaprachaya parichayo daarakirmeera bhaavaha |
    paathu sriineturasmaan sapadibuda janatraana dakshah kataakshaha ||
    The enchanting beauty of the cluster of the just blossomed dark blue lotuses that too viewing it continuously like drinking water from a jar without discontinuity is negated by a side glance of the exquisite side glance of Sri Bhoo Durga (Goddess Lakshmi) and this special colour of just her glance also obliterates the arrogance of the sheen of the moon which has risen from the milky ocean. This beautiful glance reaches the eyes of the Lord Pundarikaaksha and enhances it whose power is capable of protecting the suras (devas) and bhoosuras (virtuous men) may also protect us with the utmost promptitude.
    The above shloka is as usual the bendictory verse to Lakshmi Narayana but the alankaras and the metre involved is really incomparable. We are reminded of the seventh chapter of the Dwadasha stotra where similar opinions are voiced by Srimadaacharyaru. (Sriyat kattaaksha balavatyajitham namami…) In this poem we find the unique Prateepa alankara where the Upamana (Lakshmi) is given prominence when compared to the Upameyam (Moon, Lotus, etc.).
    Also, the author does not merely stop to say that the loving glance of the Lord (as said in the Dadi Vamana Stotra – Chandrakoti Susheetalam) protect the Devas and the Bhoosuras (virtuous) people but also without wasting any time protect us also. This is called Parikara alankaara.The above passage has one more meaning that we may also be elevated to the level of at least the Bhoosuras by the benign grace of Sri Harih.
    2nd Sloka:
    maathashtvaaamupakalpitaakhila jagatjsargejagabhargedite
    chetenaprajahaatu jaatuchititaha svargepavargepinah |
    kaarunyamkurumaakritaamayi punardurgevisargematim ||
    The second shloka also eulogises Sri and in this one shloka also highlights the greatness of Her qualities as Goddess Durga also by the saint. Oh! Godess Lakshmi you are Lakshmi and Durga , the mother of this whole Universe and you are the creater of Brahmaadi Devaas (under the aegis of Lord Narayana) and your extraordinary effulgence nullifies the beauty of the divine group of women. Wherever we are, in this earth or in heaven please ensure that we do not live a life of oblivion about you and be kind enough to grant our deserving wishes (according to the svaroopa of the soul) and when we are in poverty (materialistic and spiritual) kindly do not foresake us. In short let us be blessed to be thinking about your feet always.Here in this shloka Sri Vadindraru has effectively made use of the Adisayokti alankara (which stimulates us to wonder).
    3rd sloka:

    Srimadraamaabhiraamaamita mahima padaprouda paathoruhaalih |
    krishnaanishtaamitakshma parivrudapatalee paatanaika praveenahah ||
    vedavyaasopadeshaadhika samadhigataananata vedaanta bhaavo |
    bhooyaat keechaavaneeshaa vratitanuranilah sreyase bhooyase nahah || -3-
    The saint poet Sri Vadindra Teertharu then renders a mangala shloka in the praise of the three avataras of Sri Mukhyapraanaa. May Mukhyapraanaa who is very dear to the Lord is hovering like a bee in the vicinity of the lovely lotus feet of Sri Ramachandra, in the incarnation of Sri Bheemasena had the wonderful capacity of destroying single handedly innumerable emperors (Jarasanda, Duryodana and the like) who were enemies of Sri Krishna (both Sri Yadava Krishna and also to Draupadi who is also called by that name) and in the last avataara as Sri Madhaachaaryaru learnt the purport of the Vedas, Upanishads and other shastras under the feet of Sri Vedavyaasaa and rendered the meaning of the same in the form of the Brahma Sutra Bhasya, bless us
    bountifully with all the Purushaarthaas including Moksha saamraajyaa.
    In this shloka the poet refers Vaayu Jeevothama as a bee because the bee is not satisfied by drawing out nectar from one particular flower and goes on sucking honey from various flowers so also the Haribhaktas and Daasaaas are not exhausted by the nectarine delight of the names of the Lord and endlessly drink the elixir of various divine names. The verse starts with “sri mad raamaabiraamaa” which is a case of “vritta anupraasa alankaraa” as the name of raama is used twice for the purpose of getting the correct metre.(similar to that of rain rain go away, twinkle twinkle little start etc.). “tadroopaa ubhaya roopaaalankaaraa” is used when Sri Hanumantha is described as a bee at the feet of Sri Ramachandra prabhu.
    4th shloka
    Udvela vyaasata tantra vyasavsitanikhilaabhijnahradyaanavidya
    nantatrayyantabhaava prakanaghatanaa sarvatantre svatantre/
    samvarnye mantravarnairanitaravishayasparshibhih paavamaane
    roopelokaikadeepe prasaratuhyadayam maamakam madhvanaamni//
    The saint is not contended with bowing to mukhyapraana in the previous shloka continues to pray the foremost preceptor of madhva tradition sri madhvacharya with great reverence in this shloka.
    Let my mind and heart reach and hover around the third avataara of Sri Mukhya praanaa who had grasped all the prameyaas flawlessly and also the upanishad vaakyaas and works of Sri Vedavyasa with special reference to the Brahma Sutras, who always stressed upon the greatness of Sri Vedavyaasa alone,whom the vedas (Balittha suktha etc) glory and one who increases the gnaana in the intellect of the saativika souls. (In the shloka, paavamaane means one who purifies ). The verse is again in the sraghdara metre and the poet uses vrittaanupraasa alankaara while using the words sarvatantre,svatantre,samvarnye,etc.(alliteration).
    5th shloka
    vijyaanodarkatarka gratipadamdhurodaarasandarbhagarbha
    proudaanekaprabandha prakatitha bhagavathpaadabhaashaadi bhaava/
    mithyaavaadaapavaada prakupitavimatadhvaantasantaapabhaanu
    jeeyaadanyairajayyah tribhuvanaviditaascharyacharyo jayaaryah//
    In this shloka teekachaaryaru is propitiated by the poet. May Shri Teekaachaaryaru who is honoured for Nyaya Sudha and other wonderful works which are of excellent verses and captivate the minds of the scholars and bereft of unwanted jargon is replete with logic which contains the essence of the Sutra Bhaashyaa of Srimadaachaaryaru and the sarva moola and personification of jnaanaa and bhakthi ,who is like bhaanu(resplendent sun) which removes the rows of darkness in the form of mithyajnaanaa and the like and the saint who is unconquerable and famous in all the three worlds, stand none to excel.
    Sri Vyasaraaja tirtha has composed a song on Sri Jayatirtha on similar lines as follows:
    Amita divjaavali kumudangalarisi vimatara mukha kamangala vaadisi………
    Aarthi mandaara vedantha vichaaraa, samastha Sri Krishna Padaambuja lola.
    The words vimata dvaanta santaapa bhaanu is a example of roopakaalankaaraa. Vaadopavvada,ascharyacharyo are examples of vritti anupraasa alankaaraa.
    Shloka 6
    Senaabaaseeraseemaa samudithaviditaabaadayodhaadi netha |
    maayaasiddhaanta deekshaavighatanaghatana sarvatantra svatantrah
    sriraamavyaasadaaso vilasati vibhudeendraabhidah samyameendrah ||
    The poet next eulogises the 11th pontiff of matha, Sri Vibhudendra tirtha. Let Sri Vibhudendratirtha, the ardent disciple of the brilliant srimadaachaaryaru and the foremost of the unbeatable warriors of the batallion of the gods and pandits, who can establish the dvaita vedanta without help from anyone and defeat the maayaavaadins and who continuously worships Sri Veda Vyaasaru and Sri MoolaRaamachandramurthi, shine effulgently.
    In this poem it is highlighted that Sri Madhvacharya and Vibhudendra tirtha both have in common the svabhava or nature of silencing others and hence is a classic example of Svabhavokti Arthaalankaaraa. By using the word vighatanaghatana the poet has used the chekaanupraasaa alankaara. Sarvatantra svatantre is vritti anupraasa alankaaraa.

    Sloka 7
    Maayaatantraamararismayamapanayato madhvasiddhaantanaamno
    netraaneevatrayopithrijagathi nrharerindhate yatprabandhaah |
    Yadvagadvaithavidytaachalakulishapraudimaadaukate sah
    sreyobhooyo vidadhyaatsumahitamhimaasamprati vyaasaraajah || 7
    A prayer is now addressed to the great Vyaasaraaja Gurusaarvabhauma.
    May Sri Vyasaraja who is famous for his ratnatraya (Taatparya Chandrika, Nyaayaamrita and Tarkataandava) which resemble the three glowing eyes of Sri Narahari in the garb of Dvaita Siddhanta in obliterating the arrogance of Hiranyakashipu the foe of the gods who declared himself as god, as a Vajraayudhaa or the thunderbolt of Indra which could smother the Advaitic mountains, take compassion on me and bless me here and hereafter.
    In this verse the upameyam is the three works of Vyasaraja tirtha and the upamanam is the three eyes of Sri Narasimha. Since the upameyam does also the work of upamanam it is a case of Ubhaya saadaarana dharma. Though the upameyam and upamanam are similar in action but are different entities it is a case of Poorna upamam which leads to Arthaalankaaraa.
    Netrena trayopi is a case of Anupraasaa alankaaraa.
    Shloka 8
    dhootaaraati prabandah sfutaviditachatuh shashti vidyaavisheshah |
    soyam nah srisurendravrativaratanayodvaitashaivaasahishnoh
    pushnaatu sri jayeendraadrastribhuvanaviditah saratantrasvatantrah || 8
    The poet proceeds to offer obeisances to the Chatushashtih Kalaa Purna, Sri Vijayeendraru. Sri Vijayeendra tirtha who has to his credit one hundred and four wonderful books which are effective in opposing other shastras and establishing Tatvavada, who is a master of the sixty four arts like music, crafts, dance, idol making and the like, who staunchly opposed the Saiva and Advaita religions, who suceeded to the pontificate after Sri Surendra tirtha, who is a sarva tantra svatanra (do not need external help to know other sidhantaas) and famous in the three worlds, may be pleased to take care of us.
    It is said that the Saint used to carve within half an hour a Udupi Krishna idol and present it to some lucky devotee. The Saint had written 104 works superseding Appayya Diskhitar who had written 103 works. Here the ashrama guru of the Saint, Sri Surendra tirtha who was known for his penance and Bhoo pradakshina is very much honoured.
    The verse is decorated by Roopalankaara while describing the Chaaturyaa of Sri Vijayeendra tirtha and the metre is Sraghdara metre.
    Shloka 9
    vyaadutavadya hrudtaamitha kruthi rachanacharu chaaturya hrushyat
    karnatakshonipaala pratipadarachita aneka ratnabhishekaha |
    patrisharooda lakshmipathi padanalinodh agrolamba leelo
    vikhyatah srisudheendra vratipatiratulam bhadram unnidhrayen naha || 9
    Sri Sudheendra Teertharu who is the personification of fame and story and also has the blessed capacity of being the another of blemishless and wonderful granthas like “sahityasamrajya” and the like had been honoured by the king (many kings) of Karnataka by the performance of Ratnabhisheka (showering of priceless gems) not once but in several occasions. The hallowed saint is compared to a bee that hovers around the feet of “Patrisharooda” (the Lord and his Consort on top of Garuda). Sri Vadeendra prays that such a holy saint may be kind enough to bless us with all auspicious merits.
    Vishesha Artha:
    The saint was well versed in the shaddarshana (Sankhya, Yoga, Nyaya, Vaiseshika, Purvamimaamsaa and Uttaramimaamsa) and hence called as Shaddarshanacharya. Since he was the recipient of various gifts and titles from a plethora of kings he was also addressed as Rajamanya. The poet says that His Holiness had composed Sahitya Samrajya and other works. Some of them are Sadyulesi Ratnavali (on Tarka tandava of Vyasaraja Teertha), Sutra Pradipa (on mimamsa). 2 books on Alankara (Alankara manjari and Nikhasa) and a nataka called Subadra parinaya and Dayalu Shatakam (a stotra). The saint had also written a lucid commentary on the Bhagavata Purana (2nd and 11th skanda). The Gwalior Maharaja, Raghunatha Bhoopala Nayaka of Tanjavur and the Vijayanagara Samrat has accepted His Holiness as their Rajaguru. and the former had conffered the title “Digvijaya Simhasanaadeeswara”.
    Apart from writing many works His Holiness used to do elaborate puja to the holy dieties and idols of the matha and the Visraha used for His upasana (Garuda vahana Paramaathma) can still be seen adorning the residue of idols of Rayara matha. Last but not the very least His Holiness cannot be afforded to be forgotten because he was the most fortunate and blessed saint to have ordained Mantralaya Mahaprabhu Gurusarvabhouma Sri Raghavendra Teertha into sainthood and gave the whole world the Kaliyuga Kalpataru.

    Shloka 10
    rvacah pracam pravacamupacayamabhajan yatkrtajranthajalaih sankhyavanto yamahurmuhurakilakalamurtimudvelakirti-
    rdhira SriRaghavendrah sa disatu satatam bhavyamavyahatam nah ||10
    Namaskara to one who has written works to remove ignorance, and that which has been revered by many scholars, one who has highlighted the great works of predecessors and who is glorified by many people – none other than the great Sri Raghavendra teertharu. The saint prays His Holiness to shower his anugraha.
    Shloka 11
    ye ramavyasapadapranihitamanaso madhvatantrapratista-
    dhuryamaryadasamvitsumahitasumatindraryasisyagranyah |
    prakhyatan tanupendravrativibudhamanin desikanasraye’ham || 11
    Here the greatness of the ashrama guru of Sri Rayaru Sri Upendra teetaru is described as one who always meditates on Sri Raama and Vedavysa and also one of the famous disciples of Sri Sumateendra swami and also One who is always contemplating on shastras and also praised by saadhoo janas. Namaskara to such a great saint.
    Shloka 12
    yogo yah karmanama kavibhirabhihito yasca vijnanasanjnah
    sakto nasiddhakayastanumatiranayostavadavarjane’ham |
    yascopayairupeyah sthiraphalavidhaye desikasyaprasada-
    stasmai tasya stuviyanisamapi caritam raghavendravratindoh || 12
    In this shloka in all humility the great saint feels that it is impossible to try to reach the Lotus feet of the Lord by both jnana marga and karma marga,since this body is ephemeral and the saint feels that one can only be saved by Sri Raghavendra Swamiji’s benign grace which in turn is only possible if we constantly cherish the greatness and compositions of Sri Rayaru.
    Shloka 13
    esa sriraghavendravrativaracaritam bhonidhih kkativelah |
    kkasau khadyotapotapramusitavibhavascetaso nah prakasah |
    vandhyaivatah pratijna tadatulanikhilascaryacaryabhidhane
    sthane thapi kkacit syadiha punarudadhisnanasa lpavat syat ||13

    Sri Vadeendra Theertha admits though he is not able to fully exhaust the greatness of Rayaru, he has just attempted to bring out the same in the sloka.
    It exhibits the great humility of His Holiness. Just like one gets contended of having taken bath in the sea by doing so in the corner of its shore. So also Shri Vadeendra Theertha feels that even highlighting few of the glories of Shree Rayaru. It is felt that Sri rayaru has been glorified. Indeed is it possible to fully exhaust the greatness of His Holiness.
    Shloka 14
    yadbhanau yatkrsanau yadamrtakirane yad grahesuditesu
    jyotiryattarakasu prathitamanisu yadyacca saudaminisu |
    sambhuyaitat samastam tvadamitahradayakasaniryatprakase
    dhira sriraghavendravrativarabhajate hanta khadyotaritim ||14
    The poet continues to praise the greatness of the compassiante saint in this verse also as under:

    “The scorching brilliance of the sun,the scathing heat of fire. the cool and pleasant light of the moon, the scintillating radiance of all the stars put togther and the rays emanating from all the gems are put together will produce a light that will only be like a firefly before the sun of mellifous radiance emanating from the heart of Sri Rayaru which hosts the Lord.The poetic imagination of the author reaches the zenith in this verse and adds a tinge of flavour to the kavya.
    cittenayuktamartham kalayati sahasa nabhidhatte na sadbhih
    sakam mimamsate va na likhati vacasodghatayatyasayam svam |
    uktam no vakti bhuyah kvacidapi likhitam naiva nirmarsti tasma
    dasmabhih satprabandhapranayanavisaye stuyate raghavendrah || 15
    Here the greatness of the works of Sri Rayaru is brought to limelight. Guru Sri Raghavendra swamin- Your Highness always think about correct knowledge,never mention anything that has not been uttered by jnanins there is absolutely no redundance in any of your works which implies every time a new theme is highlighted never erase what has already been written so it is imperative that all glorify your great works.
    dhirasriraghavendram krtanijavijayasragdhararthaprakasam
    drstva santhustacetah dasamatiraciradabhyasincatpade sve |
    nunam vani tadiyananalinagata tatkrtasvapriyaika
    pratyasangaprahrsta svayamapi tadanu sve pade cabhyasincat || 16
    In this shloka the reference of the gloss on the prameya navamaalika (which comprises of 32shlokas) is mentioned. Mantralaya swamin – In your poorvaashrama your holiness authored a gloss on the prameya navamallika and since it dealt with elaborately on the greatness of Mukyaprana and his glories deeds ,his consort Sri Bharati devi decided to install Venkatanatha on the vedanta samrajya.
    This wonderful work known as gooda bhaava prakaashika helps scholars to understand the original work .
    grantho vadavali dragabhajata vidito durmataranyadahat
    apurvardhapratipakramaparipathitasvabhidhagocaratvam |
    tasya sriraghavendravrativara bhavato vayuvamsaprasute
    retarhyuddhipanam yattaducitamitti me manasi vrttirindhe || 17
    Sri Teekaakritpaadaru(Sri Jayatheertharu) had written a work called vaadavaali to help to remove the ignorance and the gloss by Sri Rayaru highlighted it more.If the first two letters of vadavali are interchanged it becomes daavaavali or forest fire which destroys ignorance . Indeed this work of Your Holiness is burning brightly in my heart always like the brilliance of a forest fire- thus opined Sri Vadeendra Theertha sripadaru.
    vandarupranicetah sritatimiraparibhavakausalyabhajh
    tejaste raghavendra vrativara kimiti srimato varnayamah |
    yenaisa candrika pi tribhuvanavisada satpathodancitasrih
    lebhe sarvajnamauliprakatitavibhava tvatta eva prakasam || 18
    This shloka highlights the greatness of Prakasha(tippani of Sri Rayaru on the work Tatparya Chandrika of Sri Vyasrajaru).Can there be any doubt that the Prakasha(light) of Chandrika(moonlight) will dispel the darkness of ignorance of devotees. Sri Raghavendra Guru Sarvabhauma ! The moon which is flawless spreads its light all over the world so also Chandrika Prakaasha too gives light of knowledge to saadhu jana samuha.

    dhirasriraghavendra tvadatularasanaranganrtyatsvayambhu-
    yosa-dhammillabharaslathakusumatatistvagdirah sangiramah |
    yabhih sammisritabhirniravadhivasudha visruta sasudha pi
    ksonigirvanagamyam parimalamatulam sampratam samprapede || 19
    Sri Rayaru is also hailed as Parimalacharya as His holiness had written a work on the famous Sri Man Nyaaya Sudhaa of Sri Teeka krit padaru. It is believed that in His poorvashrama Venkatanatha used to sit in the late hours writing this memorable work and once Sri Suddendra Teertaru himself saw the young boy lying down after writing for that day and His Holiness was much impressed and conferred the title of Parimalacharya’ on him since it gave an exotic fragrance to the intellect.
    Sri Vadindraru here in all poetical excellence compares the tongue of Sri Rayaru as a stage and Sri Saraswati devi joyfully dances on it and the flowers strewn on it from here are the words by which this fragrant work has been done. Is it not natural that it should be hailed as Sri Sudhaa Parimala.
    prayah praganyadiyatanutaravivrti granthavasovihina
    hrina nadarsi dhirairapi kila yuvatirbhasyatikabhidhana |
    adya sriraghavendravratikrtavivrtipraudhakauseyaratnam
    svehayuktam vasana viharati sudhiyamagratah svairiniva || 20
    In this shloka Sri Vadeendraru compares the wonderful work Tatva Prakashika as a young maiden who rarely ventured out due to paucity of a good dress in the form of a gloss. Sri Raghavendra Swami allieviated the concerns of the pandits by writng a remarkable work Bhaavadeepa on tatva prakashika and it is needless to say that the maiden sported with new suitable dress .

    grantho’yam nyayamuktavaliriti bhavata raghavendra pranito
    nunam muktavaliryat prathamamupacitaduddhrtastantrasindhoh | protasca jnanatantau tadanu tava gunapraudhimasamsatam nah kanthesu premabhumna bahumatividhaye va dhuna sannyadhayi || 21
    The divers dive deep into the sea and with great effort take the pearls. These in turn are made as a beautiful necklace and presented to deserving people. Simlarly, from the sea of siddanta,the pearls called adhikaranas have been taken by Your Holiness and woven into a garland(using theintellect of your Holiness as the sacred thread) called the wonderful work called Nyaya muktavali and presented to the pandits with your blessings. Is it not the greatest khanta bhooshana to them.
    hantananto’ nubhasye vilasati bhagavatpadasamvarnito’rthah
    satyam pratyetu lokah kathamidamadhuna tasya tikam vina te |
    dhira sriraghavendra vrativara nivasadvisvamasyantarale
    stoke tokasya saureratibhrsakupitam tatprasumantareva || 22
    In this shloka the saint eulogises the greatness of tattva manjari a unique gloss by Sri Rayaru on the anubhasya of Sri Madhwacharya. It comprises of 32 verses in four chapters which encompasses the meaning of the brahma sutras and also tradition avers that acharyaru composed it to enable Achyuta preksharu to do parayana on sadana dwadashis when entire recitation of brahma sutra bhasya was difficult.
    Sri Vadindraru beautifully alludes this with the incident of Lord Sri Krishna showing the entire universe to mother Yashoda in his small mouth. Sri Rayaru in tattwa manjari has clearly brought out the fact that the meaning of the entire bramha sutra is embedded in the anubhashya. Obeisaance to the great Rayaru who has composed such a wonderful work.

    bhinnairarthairanekaprakaranabhanitairadya madhvagamabdhau
    matya bhuyo vicintya srutiparinataya sastaya sangrhitaih |
    sutresvekaikaso pi vrativara bhavata yojitesu pravacam
    modo yavanna taddak tava punaritarai raghavendra prabandhaih || 23

    Sri Raghavendra Gurusarvabhauma.
    Your Holiness have showered great mercy on your devoteesby diving again and again in the ocean of madhva sastra and brought out various meanings for the sutras ofBadarayana in the great work called TANTRADEEPIKA. The learned scholars are exhilerated overthis great blessing by Your Holiness. This indeed servesas a beacon light for the learners of Brahma Sutras.

    dhira sriraghavendravrativara sujananugrahavyagracitai-
    racaryaih sangrhitah katicana manavah sarabhutah srutibhyah |
    tanevoddhrtya bhuyah sruitsu nidadhata sisyavargopaklaptyai
    loke sadhu vyadhayi srutaguna bhavata” caryanuvrttih || 24

    Sri Madhwacharaya had presented to the devotees a collection of many mantras in the composition called Tantra saara sangraha.Jagadguru Sri Madwacharya while explaining the efficacy of this grantha says,
    “Grantoyam paata maatrena sakalaabheesta siddhitah”.The recitation of this grantha itself is sufficient to get all our desires fulfilled then what could be said if it is attempted to understand it.

    vyacaksane muradvisyabhijanamabhajad bhadramindoranidram |
    dhira sriRaghavendra tvayi punaranaghe hamsavamsodite tam
    vyakurvatyadya bhavyam kathamiva na bhajedasu mitranvavyah || 25
    This shloka highlights the greatness of the excellent work on the Bhagawat Geetha by Sri Rayaru popularly known as ’Geetha Vivritthi’. The chandra vamsha was exhilerated because of the Lord telling the song celestial to Arjuna (which destroys the sins of those who read the same) and while Sri Raghavendra Gurusaarvabhaumaru wrote vivrithi the hamsa vamsa felt honoured similarly (Hamsa in one context means sanyasis in another aspect can be taken as soorya and hence soorya vamsha also felt glad).

    na syadisaprasado guruvarakarunamantareneti rudho
    dhira sriraghavendravrativara suddadhascetasaste vipakah |
    yenavyakhyaya gitamapi gurucaranodaratadhasyatika-
    vyakya vikhyatavidvanmaniganavinuta’kari bhuyastvayaiva ||26

    Munisreshta Sri Raghavendra sarvabhauma out of great respect towards guru Teeka kridpaadaru and of sheer mercy on the scholars your holiness decided to write a commentary on the Pramey deepika (tippani on the geetha bhasya of Jagadguru Sri Madhvacharyaru).

    This great work also brought to light that without guru’s grace Lord’s grace is not possible.Guruvina gulaamanaaguvatanakaa… has to be remembered over here.

    nanatantraprasangatribhuvanaviditodarasarasvato pi
    pratnanekaprabandhapravacanaracanvittatatatkausalo pi |
    sasvad vyakhyatagitakrtirapi vibudhanugrahaikagracitto
    gitatatparyatikavivaranamakarodadbhutam raghavendrah ||27

    In this verse the greatness of the gloss on Nyaaya deepika (a commentary on the teeka of the geetha taatparya of Srimadaacharyaru by Sri Teekakridpaadaru) is brought to limelight by Sri Vadindraru.

    The saint opines that the work was composed by Sri Rayaru purely out of his benign attitutde towards the scholars .

    laksminarayanaryastava tanayamanih satsu sarvesu dhanyo
    yasmaddagbhasyatika tanutaravivrteranjasa tatkrtayah |
    premna vidvatsu bhuyah pracayamabhilasan raghavendra vratindra
    pravocastvam pratitavrata nicayamrcameva bhasyanurodhat ||28

    Srimadaachaaryaru composed a wonderful work on the first forty sooktas of the Rig Veda known as Rig bhaashya. It is considered to be a pioneering work of its kind.It contains various nuances of the rig veda and had been commented upon by the great teekacharyaru. One day Lakshminarayanacharya ,the poorvaashrama son of the saint had presented a work on the same and His Holiness was extremely pleased by the work.

    dhira sriraghavendravrativara sakalanyeva suktani samyak |
    vyakurvantam bhavantam vyavasitamatayo hanta nidhyasayantah
    sarve bhuyah smaranti vratasamitimanerbrahyasutrapranetuh || 29

    Dheera Sri Raghavendra!
    Your great elucidation on the sooktas namely Purusha sooktha,Hiranyagarbha sooktha,Ambhrini sooktha,Manyu sookta and Karma sooktha has created such a great impact on the scholars that it has impelled them to immediately think about Lord Sri Vedavyasaru . Such is the greatness of your work!!
    yavadvedantakhandapravacanakrtini premabhuma na taddaksarvamnayapravaktaryanupamacarite raghavendravratindre|ityetaddehabhajamativisadarucau jagaruke’pi lokerakacandre dvitiyasasisakalanatinyayamevanurundhe || 30
    O Guru Sarvabhauma your concern and benign blessings on your shishyas has been very much in this work!
    Your Holiness have been kind enough to write a wonderful khandartha on the ten principal upanishads like aitreya,shatprasna,brihadaranyaka,etc that had been commented upon Sri Madhvacharya. It can be said that Your Holiness have beeen appreciated and honoured for this work the most.This work makes the scholars to understand the dashopanishads more clearly and hence all are wholeheartedly thankful to Your Holiness for the same. This work is beautifully compared to the shukla paksha trutiyachandra darshana by the author.

    hradya tika’navadya paravivrtayajussamasambandhini temalinyaksalanambhah svayamajanihareruttarange ca murdhni |saivarca raghavendra vratisamitimane’nanyasamparkabhajamaujisthe daksinange mrgamadamilitodgarapatirasarah || 31
    Oh yatisreshta Sri Raghavendra Swamin! the gloss on Yajur and Sama veda written by Your Holiness is so wonderful that it has cleared all doubts on them hitherto like clearing the left shoulder of Sri Hari whereas that on the rig veda and upanishads have annointed sacred musk on the right shoulder of the Lord.Indeed great are your works!

    nunam vakyanurodhiprakaranamakhilam neyamityuktamuccaihpracam vacamyamena prakatitavibhavanantavedantavaca |svaminnetatpratiyah katamiva kavayo raghavendra vratindoyena tvadvakyajatam prakarananikaram tavadadyanurundhe ||32
    In this verse Sri Vadindra teertharu highlights the greatnesss of Mantralaya Mahaprabhu of giving a very lucid commentary on the dasaprakaranas of Srimad Ananda teertha bhagawad padaru in such a way that it can be easily understood by the readers. Only a great sainly scholar like Your holiness can only undertake such an arduous task and help the scholars.
    Sri Vadindraru states,that the tippani of Your Holiness brings to light the means of both the moola grantha and also the teekas of the dasaprakarana.

    Vikhyatasrisudhindravratisuta bhavata sadhugite sutarkesadyah pratyarthihradye munimaniracite tandave yojitarthe| pratyakhyataprakasah samajani bhuvane hanta cintamanistvambruhi sriraghavendravrativibudhamane kastvadanyo vadanyah ||33

    Sri Raghavendra Gurusarvabhauma, the uttama shishya of Sri Sudeendra and a great sanyasin is Your holiness is renowned for only being of great help to others. The great gloss called Nyyaya deepa on the wonderful workof Tarka tandava of Sri Vyasa Raja Gurusarvabhaumaru is so exquisite that it melts one heart and makes onedance with joy.

    praudhanekaprabandha pravacanaracanalabdhavistrabdhakirteste kim nyayamrtasyavivaranavidhina raghavendrayasah syat|yadrajyapracyavenakhilabhuvanapate raghavasyeva kirtih labdhaiva pratyutalam gurucaranakrtamodanirvahajanya ||34

    Mantralaya Mahaprabhu, though Your Holiness have not written a commentary on the nyaayamrita even then your eminence had been enhanced since Your holiness have exclusively taken it for paatha for your shishyas.It has already been highlighted in this work that two works of Sri Vyasa Raja Gurusarvabhauma,had been commented upon by Sri Parimalachaaryaru.

    Sri Vijayeendra Gurusarvabhauma,had already written a work called Amoda which had been wonderfully explained to the shishyas and hence the keerthi of Sri Rayaru had enhanced manifold.
    vaca sanksiptaya yadvahucaritamupavarnayastvam murareh
    kinca sriraghavendra vratipa raghupatestena no vismaye’ham|
    kimva duh sadhyamasti trijagati mahatamatmanah panipadme
    pasyamando marandah kilaghatajanusa colirakari sindhuh|| 35
    This shloka highlights the greatness of two works Sri Rama charitra manjari and Sri Krishna charitra manjari which comprises of 11 verses and 28 verses respectively. The greatness of Sri Rayaru is clearly evident in these works where the great saint has condensed the crux of the great epic in just 11 verses and the entire dashama skanda of Sri Mad Bhagawatha in 28verses. The author of this poem also says that for great mahans like Sri Rayaru it is not a very big task.
    Sri Vadindraru beautifully gives an allusion about sage agastya who had just shrunk the entire ocean to help the gods . Indeed what is not possible by great personalities.

    mantrisrinilakanthabhidhamakhimanina bhattatantranubandhe
    granthe tavattvadiye karini gunavida ropite bhyarhanaya |
    kirtiste raghavendra vratisumatimane nunamanyunavega
    dirnaganaruruksuh svayamapi sahasa dyavadastau digantan || 36

    The place is Madurai,the ruler tirumalai naicker and the minister is a great scholar Neelakanta dikshitar. Sri Rayaru in the course of his divine sojourn comes to Madurai where Neelakant dikshitar is highly impressed by theBhaatta Sangraha on Mimamsa and he places the work on an elephant and takes it in a big procession throughout the streets of Madurai. Sri Vadindraru wonderfully completes by opining “the fame of Your Holiness also spread all over the eight directions like how the glory of the book is spread”.

    vyasena vyuptabijah srutibhuvi bhagavatpadalabdhararasrih
    pratnairisatprabhinno’jani jayamunina samyagudbhinnasakhah|
    maunisavyasarajaduditakisalayah puspito’yam jayindra-dadya
    sri raghavendradvilasati phaliti madhvasiddhantasakhi ||37
    The seeds of Brahma sutra was shown by vedavyasa in the field of vedas and which sprouted during the period of madhvacharya and during the period of teekakritpadaru it grew in to beautiful branches.During Vyasaraja’s Tirtha time new leaves made their appearance which later led way to the blooming of beautiful flowers by Sri Vijayendra Tirtharu and the tree of madhwa siddhantra bore wonderful fruits by Sri Mantralaya mahaprabhu and radiates brillliant effulgence all over.madyadadvaitavidyavadgarvanirvapanaksamah| vadindrayatirat tene bhaktya gurugunastavam ||38
    || iti srivadindratirthaviracitam sri gurugunastvanam ||
    ||Sri Krishnaarpanamasthu||


  526. do you have Kannada songs beda krishna ranginata seere neneude
    in kannada lyrics


  527. do you have kannada bhakti song in kannada: Thappu Nodade bandeya, Ennayya thande


  528. do you have kannada bhakti song in kannada: NOMO BHUTANATA satya harichandra picture


  529. Posted by Nirmala Rao on June 27, 2013 at 9:38 pm

    Namasthe Meera ….can you please post the lyrics of these two songs…kannada or english

    a) jaaNa neen ahudo guru mukhya prana neen ahudo – Vyasaraja theertharu
    d) sri rama ninna paadava thoro – Padaraja theertharu

    Many thanks


  530. Posted by Sujatha Rajagopal on June 30, 2013 at 9:11 am

    hello meera mam, pls I want song lyrics of this three songs in english
    loka bharithano
    2. ishtu dina e vaikunda
    3. manasu karagathae swami dhayavu bharate

    I have searched in all the web sites, but I couldn’t get, pls help me
    my mail id


    • Posted by meeraghu on June 30, 2013 at 9:36 am

      Just posted ishtu dina e vaikunda lyrics in English. As time permits, will post others as well.


      • Posted by sujatharajagopal on July 2, 2013 at 5:03 am

        Meera mam,
        Thank you so much for your kind help. Really am very proud of your service.
        Waiting for the other songs translation
        Once again thank you

  531. Posted by Lakshman on July 1, 2013 at 7:22 pm

    shrI rAma ninna. rAgA: nATakuranji. Adi tALA. Shripadaraya.

    P: shrI rAma ninna pAdava tOrO mOhana guNadhAma ninna mOhada pAdava
    A: varaguNajAla suraguNalOla karuNAlavAla taruNiya paripAla
    C: ajavara pUjita gajavara bhAvita sujanara carita trijaga vandita
    angaja caraNa shashi ranga turanga tunga tirthamalika rangaviThala
    (another version)
    angaja pramukha plavanga turanga tunga vikrama shrI rangaviThala


  532. Posted by Lakshman on July 2, 2013 at 11:11 am

    The audio for jANA nenahudO is available here. Perhaps someone knowledgeable in kannaDa can post the lyrics in English. Thanks.!q=jaana+neenahudo
