Lyrics

This page will have lyrics to most commonly sung songs in any Hindu household.
I have been using a free software called Baraha to write Kannada in English and using the normal keyboard. Within just a few minutes after you download the software you are ready to start using the program. It’s so easy. I use this software to write emails to my Mother-in-law in Bangalore.

I am also using this to write all the lyrics I am adding in my web log as well. This software isn’t just for Kannada, you can also write Devanagari, Tamil, Telugu, Malayalam, Gujarati and many other languages. I have tested my lyrics with Kannada & Devanagari. Copy all the lyrics from this weblog and paste it in the bottom half of the software, and click on the Convert toolbar button. Its really fun and easy. If you are having any problems using this software, just reply to this thread. I will help you.

If you want any of these lyrics in any particular language Baraha supports, comment to any of these pages, and I will send you the lyrics in the language you need. 🙂

Here is a screen shot of Shri Mahalakshmi Ashtakam lyrics written in Baraha:

Baraha Software at work

And here it is in Devanagari script:

Lyrics in Devanagiri

I had completely forgotten to update the lyrics page whenever I added new ones. Mr. Nandan, who is currently sending many lyrics for famous devotional songs sent me a excel spread sheet with all the titles. I made one more change and added links to those. This would help all the visitors to easily search for any lyrics they want and click on the link. So, here comes the list in alphabetical order which from now onwards will be updated as and when a new ones is added.

Name Lyrics/Stotra On

Ane Bantane Batane Bantamma
Lord Krishna
Aaruthi Belagire Goddess Lakshmi
Acharavillada Nalige Lord Krishna
Andavada toyadada chandavada padadinda Lord Krishna
Anjikinyatakayya Sajjanarige Bhayavu Inyatakayya Lord Hanuman
banda duritagaLa pariharisalu namma Lord Venkatesha
bandano gOvinda chandadi Ananda Lord Venkatesha
bandakriShNa Chandadinda banda nODe Lord Krishna
Banda Manmanasake Sri Hari Sri Hari
Baro bega baro nila meghavarna baro Lord Krishna
baro brahmadivandya vasudeva sutane Lord Krishna
Baro Guru Raghavendra Sri Raghavendra Swamy
Baro manake he Srinivasa Lord Srinivasa
Baro namma manege gopalakrishna Lord Krishna
Bhagyada Lakshmi Baramma Goddess Lakshmi
Bhagyada Lakshmi Baramma – English Translation Goddess Lakshmi
Baare Nammamanitanaka Goddess Lakshmi
Daily Tulasi Pooja Procedure Tulasi
Dasana madiko enna Lord Krishna
Dariyavudayya Vaikuntake Dari Torisayya lyrics Lord Krishna
Deva Banda Namma Lord Krishna
Dasanagu Visheshanagu Lord Krishna
Enu Sukrutha by Shri Vadirajaru Lord Krishna
Enu Sukrutha Maadidalo Taa Yashode Lord Krishna
Gajamukhane Ganapathiye Lord Ganesha
Gatika chaladi ninta sri hanumanta Lord Hanuman
Gajavadhanaa beduve Lord Ganesha
Hanuma Namma Thayi Thande Lord Hanuman
Harivarasanam Viswamohanam Lord Aayappa
Hayagreeva Sampada Stotra Lord Hayagreeva
Indu Yenage Govinda Lord Krishna
Ishtu Dina Ee Vaikunta Lord Vishnu
Ivanyaro Yeno Lord Krishna
Jagadoddharana adisidale yashode Lord Krishna
Jai Jai Vittala Panduranga Lord Panduranga
Jaya Jaya Veeve Raghavendra Sri Raghavendra Swamy
JoJo JoKrishna Paramananda Lord Krishna
Kapadu Sri SatyaNarayana Lord SatyaNarayana
Kande Naa Govindana Lord Krishna
Keshava Nama in English Lord Krishna
Keshava Nama in Kannada Lord Krishna
Krishna Nee begane Baaro Lord Krishna
kriShNamUruti kaNNamunde nintante ide Lord Krishna
Lambodara Lakumikara Lord Ganesha
Lakshmi Shobane Lyrics Goddess Lakshmi
Loka Bharithano Ranga Lord Krishna
Lord Ganesha Slokas Lord Ganesha
Mahishasura Mardini Stotra Goddess Chamundeshwari
Mahishasura Mardini Stotra in Different Languages Goddess Chamundeshwari
MangaLArati tandu beLagire Goddess Lakshmi
Nagara Panchami Haadu
Nammamma Sharade Uma Maheswari Goddess Sharade
Narayana Varma – Narayana Kavacha Lord Narayana
Nere Namdhide Lord Panduranga
Neen Yako Ninna Hangyaako Lord Rama, Krishna
Novu Talalare Hariye Lord Krishna
Pahi Pahi Raghavendra Guru Sri Raghavendra Swamy
Palayachyutha palayajitha Stotra Lord Krishna
Pavamana JagadaPrana Lord Hanuman
Poojipene Ninna in Kannada Goddess Lakshmi
Poojipene Ninna in English Goddess Lakshmi
Pillangoviya Chelva Krishnana Elli Nodidiri Lord Krishna
Prayer To Recite While Traveling Lord Vishnu
Prayer for Recovering Lost Items
Preenayamo Vasudevam stotra Lord Krishna
rAjabeediyoLagininda kastUriranga Lord Krishna
Ramakrishnaru manege bandaru Lord Krishna
Raghavendra Guru Rayara Sevisiro Sri Raghavendra Swamy
Rathava Nerida Raghavendra Sri Raghavendra Swamy
Ranga Baro Panduranga Baro Lord Panduranga
Raya Baro Thande Thayi Baro Sri Raghavendra Swamy
Sampat Shukravarada Haadu Goddess Lakshmi
Sharanara Surabhoja Sri Raghavendra Swamy
Sharanu Sharanayya Lord Shiva
Sharanu Venkataramana Lord Venkatesha
Sharanu Siddhi Vinayaka Lord Ganesha
Shiva Stuthi Lord Shiva
Sri Lakshmi Pooja Vidhana Goddess Lakshmi
Shree Siddha Lakshmi Stotra in Kannada Goddess Lakshmi
Shri Ashta Lakshmi Stotra Goddess Lakshmi
Shri Hanuman Chalisa in Kannada Lord Hanuman
Shri lakshmi Hrudaya Goddess Lakshmi
Shri Mangala Devi Ninage Pranama Goddess Lakshmi
Shri Raghavendra Stotra Sri Raghavendra Swamy
Sri Ganesha Ashtotra Lord Ganesha
Sri Ganesha Dwadasanama Stotra Lord Ganesha
Sri Hanuman Chalisa in Kannada Lord Hanuman
Sri Krishna Ashtotra Lord Krishna
Sri Krishna Ashtakam Lord Krishna
Sri Madhwa Nama Guru Madhwacharya
Sri Madhwa Nama in Kannada Guru madhwacharya
Sri Mahalakshmi Ashtakam Goddess Lakshmi
Sri Mangala Devi Ninage Pranama Goddess Lakshmi
Sri Guru Raghavendra Swamigala Aarathi Song Sri Raghavendra Swamy
Sri Raghavendra Kavacham Sri Raghavendra Swamy
Sri Rama Ashtotra Lord Rama
Sri Rama Bhajane-Sri Nama Ramayana Lord Rama
Sri Saraswathi Slokas Goddess Saraswathi
Sri Saraswathi Slokas Goddess Saraswathi
Sri SatyaNarayana Slokas Lord SatyaNarayana
Sri Venkateshwara Bhajane Lord Venkatesha
Sri Venkatesha Mangalam Lord Venkatesha
Sri Venkatesha Prapathi Lord Venkatesha
Sri Venkatesha Stotra Lord Venkatesha
Sri Venkatesha Suprabhatha Lord Venkatesha
Sri Srinivasa kalyana Lord Venkatesha
Srinivasa Bhajane Lord Venkatesha
Sheshagiri Dore Namma Srinivasana Lord Venkatesha
Sripathiyu Namage Sampadaveeyali Lord Hanuman
Shyamala Dandaka Stothra
taaraka bindige Lord Rama
Thoogire Rayara Sri Raghavendra Swamy
Thugire Rangana Thugire Krishnana Lord Krishna
Thunga Theeradi Ninta Suyativara on Shri Raghavendra Swamy Sri Raghavendra Swamy
Thunga Theeravirajam Bhajamana Sri Raghavendra Swamy
Tulasi Pooje Slokas Tulasi
Vande Vandyam Lord Krishna
Vandipe Ninage Gananata Lord Ganesha
Varava Kode Thayi Goddess Lakshmi
Vatasavithri Pooja Sloka
Veera Hanuma Bahu Parakrama Lord Hanuman
Venkatesha Bedikombe krupeya paliso Lord Venkatesha
Venkata Ramanane Baaro Lord Venkatesha
Venkatachala Nilayam Lord Venkatesha
Vijaya Kavacha
Vyarthavallave janma vyarthavallave
Yeddu Baruthare Noode Sri Raghavendra Swany
Yenagu Aane Ranga Lord Krishna
Yenu Dhanyalo Lakumi Goddess Lakshmi

1,141 responses to this post.

  1. Posted by Ujjwal Bedi on October 14, 2019 at 5:45 am

    I was listening to this Beautiful Bhajan ‘Amba Parameshwari Jagadamba Parameshwari’ Bhajane by Kanchi Gopalakrishna Bhajana Mandali, Kadatoka – tabla by G K Hegde (Harikeri)
    Can someone kindly post the English Lyrics please. Sai Ram!

    Reply

  2. Posted by Abhishek Soti on October 5, 2019 at 2:40 am

    I want lyrics of Abhyam Abhyam amma….
    In devnagri or at least in english.

    Reply

    • Posted by Shubhakara on October 9, 2019 at 4:17 am

      Requesting please send us lyrics Shiva sajira gojira (bhajan)

      Thanks & Regards Shubhakar

      On Sat, 5 Oct 2019, 21:16 Kalpavriksha Kamadhenu, wrote:

      > Abhishek Soti commented: “I want lyrics of Abhyam Abhyam amma…. In > devnagri or at least in english.” >

      Reply

      • Posted by thammanna_ynk@yahoo.com on October 12, 2019 at 9:22 am

        Respected madamAs required by Mr. Sudhakar his first request for  “abhay

  3. […] have added several lyrics on Shri Raghavendra Swamy in this blog, you can look for those at the lyrics page, or click on the Shri Raghavendra Swamy categories section and you will be listed with several […]

    Reply

  4. Posted by K Naresh Kumar on July 3, 2019 at 9:17 pm

    Lyricist of Telugu Light song Sundara Sarada Yaminilo – Can you pls help

    Reply

  5. Posted by Kalpana Kulkarni on July 2, 2019 at 11:14 am

    I need the English transalation for Keshava Nama – isha nina charana bhajane

    Reply

  6. Posted by Thammanna on May 17, 2019 at 12:08 pm

    I didn’t understand your problem. Pl elaborate . I shall try my best to help.

    Reply

    • Posted by Lakshman Ragde on May 17, 2019 at 1:18 pm

      Some music enthusiasts ask me for notations. Most of the notations are in Tamil. Occasionally there is a request for notations (in English) for a Kannada song and I am not able to oblige because the notation is in Kannada. For example I have Jayachamaraja Odeyar’s book of songs with Kannada notations but I am unable to convert them into English. Any help here would be appreciated. Thanks.

      Reply

      • Posted by P.S.Thammanna on May 17, 2019 at 11:04 pm

        Dear Mr. Lakshman
        I have no knowledge about music and musical notations, As I understand BRH is best to create transliterated text files from one language to other.
        Rgds
        P.S.Thammanna

      • Posted by Kamaleshaiah Mathavara on July 7, 2019 at 11:28 pm

        My mother tongue is kannada. I am willing to translate.

  7. Meera: Can you convert pdf notations in Kannada into English notations using Baraha? Thanks.

    Reply

  8. Posted by Lakshman on March 23, 2019 at 12:29 pm

    Meera: How come the last posting is from September 2016? What happened to the latest postings?

    Reply

    • Posted by Lakshman on June 15, 2019 at 8:56 pm

      Meera: Are you away on a long holiday? I have not seen your response to my query of May 15th. Thanks.

      Reply

      • Posted by meeraghu on June 18, 2019 at 5:12 pm

        Hello Sir, it has been a hectic couple of months with travel, work and at home. Since the comments are auto approved didn’t see any, nor did I login here. I will keep up to date from now onwards.

  9. Posted by Lakshman on February 18, 2019 at 3:42 pm

    buddhi mAtu hELidare. rAgA: shankarAbharaNa. Adi tALA. Purandaradasa.

    P: buddhi mAtu hELidare kELa bEkamma magaLe mana shuddanAgi gaNDanoDane bALa bEkamma
    C1: atte mAvaganji koNDu paDeya bEkamma magaLe cittadollabhanakkareyanu paDeya bEkamma
    hottu hottige maneya kelasa mADa bEkamma magaLe hattu mandi oppuva hAge nuDiya bEkamma
    2: koTTu kombuva neNTaroDane dvESa bEDamma magaLe aTTu umbuva kAladalli Ata bEDamma
    haTTi bAgilalli bandu nilla bEDamma magaLe kaTTi hALuva gaNDanoDane siTTu bEDamma
    3: nerehoreyavarige nyAyavannu hELa bEDamma magaLe garuva kOpa matsaravannu mADa bEDamma
    parara nindipa hengaLodane sEra bEDamma magaLe guru purandara viTTlana smaraNeya mareya bEDamma

    Reply

  10. Posted by Swathi K L on January 28, 2019 at 8:58 am

    Hi.. could anyone please provide me the lyrics of thaayi bandu nelasu indire ennaya manadaanandadi….

    Reply

  11. Posted by Bhargavi on December 7, 2018 at 8:00 pm

    Namskaara.
    If anyone knows this bhajan ‘Anthaka mardhana sainath, anthya sahaya sainatha,aapad bhandava sainath, arthtrana sainath, jai guru Deva sainath, saadha shiromani sainath

    Reply

  12. Posted by Lakshman on November 20, 2018 at 11:38 am

    indu nI karedutAre. rAgA: madhyamAvati. triviDe tALA. Kanakadasa.

    P: indu nI karedutArE bArade shrI gOvindA tA munidu irE
    virahadeli nAnondu sairisalAre tandu ni tOre
    A: nondu manadAnandadindali sandaNada mAtinda sndhisi
    endigagaladAnandadindali hondugUDise mandagAmini
    C1: kAlillade ADida vEda tanditta kAlilladavana potta
    amrtavanitta kAla tUgi nODutta gaja uNmatta kAlinidali
    koluva rUpadi kAlinali tAnaLada mEdini kAlinindali
    paDedu gangeya kAlnindali naDeda bhArgava kAinali
    uddharisi shileyenu kAlinali kALiyena mardhisi
    kAlinali tripurava gelidana kAligeraguva tEjirUDhana
    2: evaikkadale nODida taleya taggisi kavalu dADiyoLADida
    kambadimUDi tavakadindali Odida bhUbhujara kaDida
    shivana billanu muridu dEvakI kuvara nagnanu hayavanErida
    vividha dbbhiyoLADi giridhara savidu bEranu bAlagolidana
    avanikubjana koLali piDidana savari dashashira beNNekaddana
    yuvatigaLa vratageDisi kudureya havaNU gatiyeli EridAtana
    3: varamatsya nagadharana sUkarana simhana tiruka tAyittare
    dAtana varavittu shabarige turugAida nirvANana ashvArUDhana
    dhareya kAidana murUDa krUrana uravasILida vipra nrpahara
    dharaNijayavara krSNa gaganada purava pokkana tEjirUDhana
    mereva jalajana kUrmavarahana narahari dvija koraLa koidana
    narapatiya yaduvIra bauddhana turagavErida Adi kEshavana

    Reply

    • Posted by P.S.Thammanna on November 21, 2018 at 3:37 am

      ದಾಸದಾಸರ ಮನೆಯ ದಾಸಿಯರ ಮಗ ನಾನು

      ರಾಗ: ಕಾಂಬೋದಿ; ತಾಳ: ಝಂಪೆ
      ದಾಸದಾಸರ ಮನೆಯ ದಾಸಿಯರ ಮಗ ನಾನು ||ಪ||
      ಸಾಸಿರನಾಮದೊಡೆಯ ರಂಗಯ್ಯನ ಮನೆಯ ||ಅಪ||

      ಶಂಕುದಾಸರ ಮನೆಯ ಮಂಕುದಾಸನು ನಾನು
      ಮಂಕುದಾಸನು ನಾನು ಮರುಳುದಾಸ
      ಸಂಕೀರ್ತನೆಯ ಮಾಡಿ ನೆನೆವ ಭಕ್ತರ ಮನೆಯ
      ಬಿಂಕದಿ ಬಾಗಿಲ ಕಾಯ್ವ ಬಡದಾಸ ನಾನಯ್ಯ ||೧||

      ಕಾಳಿದಾಸರ ಮನೆಯ ಕೀಳುದಾಸನು ನಾನಯ್ಯ
      ಆಳುದಾಸನು ನಾನು ಮೂಳದಾಸ
      ಫಾಲಾಕ್ಷಸಖ ನಿನ್ನ ಭಜಿಪ ಭಕ್ತರ ಮನೆಯ
      ಆಳಿನಾಳಿನ ದಾಸನಡಿದಾಸ ನಾನಯ್ಯ ||೨||

      ಹಲವು ದಾಸರ ಮನೆಯ ಹೊಲೆದಾಸ ನಾನಯ್ಯ
      ಕುಲವಿಲ್ಲದ ದಾಸ ಕುರುಬದಾಸ
      ಛಲದಿ ನಿನ್ನ ಭಜಿಸುವವರ ಮನೆಯ ಮಾದಿಗ ದಾಸ
      ಸಲೆ ಮುಕ್ತಿ ಪಾಲಿಸೆನ್ನೊಡೆಯ ಆದಿಕೇಶವನೆ ||೩||

      ಕನಕದಾಸರಲ್ಲಿ ಕಾಣುವ ವಿನಯ ಶೀಲತೆಯ ಪರಮಾವಧಿ ಇದು. ಅದು ಅವರ ವಿಶೇಷಗುಣ. ಅವರ ಅನೇಕ ರಚನೆಗಳಲ್ಲಿ ನಾವಿದನ್ನು ಕಾಣಬಹುದು. ಅಂತಹದೊಂದು ಕೀರ್ತನೆಯಿದು.
      ಸಾಸಿರನಾಮದೊಡೆಯ = ಸಾವಿರಾರು ಹೆಸರುಗಳಿಗೆ ಒಡೆಯನಾದ ಕೇಶವ. ಫಾಲಾಕ್ಷ ಸಖ = ಹಣೆಯಲ್ಲಿ ಕಣ್ಣು ಇರುವ ಈಶ್ವರನ ಸ್ನೇಹಿತನಾದ ವಿಷ್ಣು.

      ಇಂದು ನೀ ಕರದುತಾರೆ

      ರಾಗ: ಮಧ್ಯಮಾವತಿ ತಾಳ ತ್ರಿವಿಡೆ

      ಇಂದು ನೀ ಕರೆದು ತಾರೆ – ಬಾರದೆ ಶ್ರೀಗೋ-
      ವಿಂದ ತಾ ಮುನಿದು ಇರೆ- ವಿರಹದಲಿ ನಾ-
      ನೊಂದು ಸೈರಿಸಲಾರೆ – ತಂದು ನೀ ತೋರೆ ||ಪ||

      ನೊಂದು ಮನದಾನಂದದಿಂದಲಿ
      ಸಂದಣದ ಮಾತಿಂದ ಸಂಧಿಸಿ
      ಎಂದಿಗಗಲದಾನಂದದಿಂದಲಿ
      ಹೊಂದುಗೂಡಿಸೆ ಮಂದಗಾಮಿನಿ ||ಅ.ಪ||

      ಕಾಲಿಲ್ಲದೆ ಆಡಿದ – ವೇದ ತಂದಿತ್ತ-
      ಕಾಲಿಲ್ಲದವನ ಪೊತ್ತ – ಅಮೃತವನಿತ್ತ-
      ಕಾಲ ತೂಗಿ ನೋಡುತ್ತ – ಗಜ ಉನ್ಮತ್ತ-
      ಕಾಲಿನಿಂದಲಿ ಕೊಲುವ ರೂಪದಿ
      ಕಾಲಿನಲಿ ತಾನಳೆದ ಮೇದಿನಿ
      ಕಾಳಿನಿಂದಲಿ ಪಡೆದು ಗಂಗೆಯ
      ಕಾಲಿನಿಂದಲಿ ನಡೆದ ಭಾರ್ಗವ
      ಕಾಲಿನಲಿ ಉದ್ಧರಿಸಿ ಶಿಲೆಯನು
      ಕಾಲಿನಲಿ ಕಾಳಿಯನು ಮರ್ಧಿಸಿ
      ಕಾಲಿನಲಿ ತ್ರಿಪುರವನು ಗೆಲಿದನ
      ಕಾಲಿಗೆರಗುವೆ ತೀಜಿರೂಢನ ||೧||

      ಎವೆಯಿಕ್ಕದಲೆ ನೋಡಿದ – ತಲೆಯ ತಗ್ಗಿಸಿ-
      ಕವಲುದಾಡಿಯೊಳಾಡಿದ – ಕಂಬದಿ ಮೂಡಿ-
      ತವಕದಿಂದಲಿ ಬೇಡಿದ-ಭೂಭುಜರ ಕಡಿದ
      ಶಿವನ ಬಿಲ್ಲನು ಮುರಿದು ದೇವಕಿ
      ಕುವರ ನಗ್ನನು ಹಯವನೇರಿದ
      ವಿವಿಧದಬ್ಧಿಯೊಳಾಡಿ ಗಿರಿಧರ
      ಸವಿದು ಬೇರನು ಬಾಲಗೊಲಿದನ
      ಅವನಿಕುಬ್ಜನ ಕೊಡಲಿ ಪಿಡಿದನ
      ಸವರಿ ದಶಶಿರ ಬೆಣ್ಣೆ ಕದ್ದನ
      ಯುವತಿಯರ ವ್ರತಗೆಡಿಸಿ ಕುದುರೆಯ
      ಹವಣುಗತಿಯಲಿ ಏರಿದಾತನ ||೨||

      ವರಮತ್ಸ್ಯನಗಧರನ- ಸೂಕರನ ಸಿಂಹನ
      ತಿರುಕ ತಾಯ್ತರೆದಾತನ-ವರವಿತ್ತು ಶಬರಿಗೆ-
      ತುರುಗಾಯ್ದ ನಿರ್ವಾಣನ-ಅಶ್ವಾರೂಢನ
      ಧರೆಯ ಕಾಯ್ದನ ಮುರುಡ ಕ್ರೂರನ
      ಉರವ ಸೀಳಿದ ವಿಪ್ರ ನೃಪಹರ
      ಧರಣಿಜೆಯವರ ಕೃಷ್ಣ ಗಗನದ
      ಪುರವ ಪೊಕ್ಕನ ತೇಜಿರೂಢನ
      ಮೆರೆವ ಜಲಜನ ಕೂರ್ಮವರಹನ
      ನರಹರಿ ದ್ವಿಜ ಕೊರಳ ಕೊಯ್ದನ
      ನರಪತಿಯ ಯದುವೀರ ಬೌದ್ಧನ
      ತುರಗವೇರಿದ ಆದಿಕೇಶವನ ||೩||
      These two are posted for the benefit of the devotees.

      Reply

  13. Posted by R Rao on November 20, 2018 at 10:16 am

    Do you have the lyrics of Indu nee karedu taare Sri govindana by Kanaka dasaru

    Reply

  14. Posted by R Rao on November 20, 2018 at 10:10 am

    Do you have the lyrics of ” Indu nee karedu taare Sri govindana” by Sri Kanaka dasaru.

    Reply

  15. Hello,

    Can anyone share some old devotional songs? I am looking for songs on Goddess Gowri/Parvati

    Reply

  16. Posted by meera on February 1, 2018 at 4:03 am

    help to find out the lyrics of lord ganesh song “phaladaya neene vinayaka”

    Reply

    • Posted by Lakshman on June 15, 2018 at 9:59 am

      Reply to Anuradha. Corrections welcome.

      dhIrAgam dhIrAjaya vIrA parivArA shrI kjAtyAyanI mangaLam
      vEda vidhAyini vEda svarUpiNi mOdamutO mamu kAvAravA
      rAvA ita rAvA datalEdA mamIdA shrI kAtyAyanI mangaLam
      rANula kellanu rANi vinivE karuNatO mammu kApADavE
      rANi shivarANi kalyANi sharvANi kAtyAyanI mangaLam
      shubhamulu cEkoTTu saubhAgyadAyini suvAsini pUjya suhAsini
      shaurI shrI gaurI hrInArI klImkAri kAtyAyanI mangaLam
      mantu koNDalapai nuNDu mahEshvari brahmANDamulakella nIvE aNDA
      aNDa mAdaNDa dAsa aNDa shrI kAtyAyanI mangaLam

      Reply

      • Posted by P.S.Thammanna on June 16, 2018 at 1:02 am

        This corrected one is posted which I feel is most suited.
        ధీరాగంభీరా జయవీరా పరివారా శ్రీ కాత్యాయనీ మంగళమ్
        వేద విధాయిని వేద స్వరూపిణి మోదముతో మము కావరావా
        రావా ఇట రావా దయలేదా మామీదా శ్రీ కాత్యాయనీ మంగళమ్
        రాణులకెల్లను రాణి వినవే కరుణతో మమ్ము కాపాడవే
        రాణి శివరాణి కల్యాణి శర్వాణి కాత్యాయనీ మంగళమ్
        శుభములు చేకొట్టు సౌభాగ్యదాయిని సువాసిని పూజ్య సుహాసిని
        శౌరీ శ్రీ గౌరీ హ్రీంనారీ క్లీంకారి కాత్యాయనీ మంగళమ్
        మంజు కొండలపై నుండు మహేశ్వరి బ్రహ్మాండములకెల్ల నీవే అండా
        అండ మాదండ దాస అండ శ్రీ కాత్యాయనీ మంగళమ్

  17. Posted by Sudha on January 16, 2018 at 3:52 pm

    Hi Madam, do you’ve lyrics for Sudhama Charite which starts like “Rama rama rama.. kodhanda raaghava, hara putra ganapa ninage……” “.,… premadinda ulive sudhama chariteya”. This is not the one by Purandara Dasaru, this seems to be a folk version. My granny used to sing this and I’ve missed the lyrics now.

    Reply

  18. Posted by Kathyayini on December 28, 2017 at 12:06 am

    Madam do u have srinivasane nee daya maado lyrics

    Reply

  19. Posted by Lakshman on November 17, 2017 at 8:05 am

    Meera: This blog is great in content but huge in size as well and needs to be updated. It is very slow to load and tries one’s patience. Is it possible for you to switch over to a website? Thanks.

    Reply

  20. Posted by sunitha on November 14, 2017 at 11:56 pm

    PLEASE SEND ME THE LYRICS OF ” MADILA THUMBUVE SRI GOWRI DEVIGE ” SONG

    Reply

  21. Posted by Menaka on November 13, 2017 at 12:48 pm

    Hi Meera, this blog is wonderful. Years of dedication and hard work have contributed to the being of this wonderful resource for anyone seeking it. I have been visiting this blog for many years now and I have found it very helpful. Please accept my heartfelt gratitude and appreciation for all your efforts and congratulations for having reached such a large, distributed and diverse audience.
    I just wanted to share an observation of mine and not sound critical… the lyrics of the song ‘Namamma Sharade’ indicate that it has been composed in praise of Ganesha and not Sharadambe. It is often wrongly referred to that way as it begins by describing Uma. But the crux of the composition is to sing about Gananatha. My two cents.
    I sincerely hope you continue with your efforts for many more years to come and in turn benefiting more generations. Thanks!

    Reply

  22. Posted by sunitha on November 11, 2017 at 2:02 am

    can u please send the lyrics of ” madila thumbuve sri gowri devige “

    Reply

  23. Can anyone please post the lyrics of Brazil Subramaniam here and to my mail id jayasrichandran@yahoo.com please, which is not available anywhere.Thanking you in anticipation.

    Reply

  24. Posted by Srinivasa on October 6, 2017 at 7:51 am

    Hi,
    Request to post this fantastic song from Dr.Rajkumar.
    Thanks,
    Srinivasa.

    Singers : Dr. Rajkumar Lyricist : Hatayogi Honnappa Nayakar Music : C Ashwath

    ಅಮ್ಮನ ದರುಶನ ಆಗುವುದೆಂತು
    ಬ್ರಹ್ಮನ ಬಾಗಿಲು ತೆರೆಯದ ಹೊರತು ||ಆ||

    ಸುಮ್ಮನೆ ಆಗದು ದಿವ್ಯ ದರುಶನ
    ಒಮ್ಮೆ ಪಡೆದು ಬಾ ಯೋಗಿಯ ಜನ್ಮ
    ಹುಮ್ಮಸದಿಂದಲಿ ಪಳಗಿಸಿ ಪ್ರಾಣಾ ||ಆ||

    ಮಣ್ಣಿನ ದೇಹದ ಸಣ್ಣ ಗುಡಿಯಲಿ
    ಬೆನ್ನಿನ ಮಣಿಗಳ ಮೂಲದೊಳಡಗಿ
    ಸೊನ್ನೆಯ ತೆರದಲಿ ಸುರುಳಿಯ ಸುತ್ತಿ
    ಬಣ್ಣದ ಮುತ್ತಿನ ಕೋಟೆಯ ಕಟ್ಟಿ
    ಕಣ್ಣಿಗೆ ಕಾಣದೆ ಮಲಗಿಹಳಲ್ಲಿ ||ಆ||

    ವಿಶ್ವದ ಶಕ್ತಿಯ ಸತ್ವವ ನುಂಗಿ
    ಶಾಶ್ವತ ಳಾಗಿಹ ಈ ಕುಂಡಲಿನಿ
    ಸ್ವಯಂಬು ಲಿಂಗನ ಸುತ್ತಿ ಭುಜನ್ಗಿ
    ಆಲಿಸೆ ಆ ಓಂ……….
    ಆಲಿಸೆ ಆ ಓಂ ಕಾರದ ಪುಂಗಿ
    ಮೈಮರೆತಿಹಳಹ ಭಾವತರಂಗಿ ||ಆ||

    ಕೇಳಿಸಿತೆಳಿದು ಭ್ರು0ಗ ನಿನಾದ
    ಕೈ ಬಿಡು ಕಟ್ಟಿದ ವಾದ ವಿವಾದ
    ನೆಲೆ ಮನೆಯಲ್ಲಿದೆ ನ0ದಾ ದೀಪ
    ಮೆಲ್ಮನೆಯೊಳಗಿದೆ ಚಿನ್ಮಯರೂಪ
    ಇದನರಿತವನೆ ಶಿವನ ಸ್ವರೂಪ ||ಆ||

    ಅನುದಿನ ದೆeeಹದಿ ದ್ಧ್ಯಾನವ ಮಾಡಿ
    ಅನುಭವದಿಂದಲಿ ಅರಿವಿನೊಳಾಡಿ
    ಅನುದಿನ ದೆeeಹದಿ ದ್ಧ್ಯಾನವ ಮಾಡಿ
    ಅನುಭವದಿಂದಲಿ ಅರಿವಿನೊಳಾಡಿ
    ಎದ್ದರೆ ಮೇಲಕೆ ಅದೇ ಸಹಸ್ರಾರ
    ಬಿದ್ದರೆ ಕೆಳಗಿದೆ ಈ ಸಂಸಾರ
    ಸಿದ್ದಿ ಪಡೆದು ತಿಳಿ ಇದು ನಿಜ ಸಾರ ||ಆ|| ||ಬ್ರಹ್ಮನ||

    Reply

  25. Posted by Sudha on August 26, 2017 at 8:10 am

    Has anybody heard of the song kodu kodu huvvana tadavanu maadade?
    Pl post lyrics and audio version if available

    Reply

  26. Posted by P.S.Thammanna on August 24, 2017 at 12:56 am

    ಗಜಮುಖನೆ ಗಣಪತಿಯೆ ನಿನಗೆ ವಂದನೆ
    ನಂಬಿದವರ ಬಾಳಿನ ಕಲ್ಪತರು ನೀನೆ ||
    ಭಾದ್ರಪದ ಶುಕ್ಲದ ಚೌತಿಯಂದೂ
    ನೀ ಮನೆ ಮನೆಗೂ ದಯಮಾಡಿ ಹರಸು ಎಂದು
    ನಿನ್ನ ಸನ್ನಿಧಾನಕ್ಕೆ ತಲೆಬಾಗಿ ಕೈಯಮುಗಿದು
    ಬೇಡುವ ಭಕ್ತರಿಗೆ ನೀ ದಯಾ ಸಿಂಧು ||೧||
    ಏಳೇಳು ಲೋಕದ ಅನು ಅನುದಿನಾ
    ಇಹಪರದ ಸಾಧನಕೆ ನೀ ಕಾರಣ
    ನಿನ್ನೊಲುಮೆ ನೋಟದ ಒಂದು ಹೊನ್ನಕಿರಣ
    ನೀಡಿದರೆ ಸಾಕಯ್ಯ ಜನುಮ ಪಾವನ ||೨||
    ಪಾರ್ವತೀ ಪರಶಿವನ ಪ್ರೇಮ ಪುತ್ರನೆ
    ಪಾಲಿಸುವ ಪರದೈವ ಬೇರೆ ಕಾಣೆ
    ಪಾಪದ ಪಂಕದಲಿ ಪದುಮ ಎನಿಸು ಎನ್ನ
    ಪಾದ ಸೇವ ಒಂದೇ ಧರ್ಮ ಸಾಧನ ||೩||

    ഗജമുഖനെ ഗണപതിയെ നിനഗെ വംദനെ
    നംബിദവര ബാളിന കല്പതരു നീനെ ||
    ഭാദ്രപദ ശുക്ലദ ചൗതിയംദൂ
    നീ മനെ മനെഗൂ ദയമാഡി ഹരസു എംദു
    നിന്ന സന്നിധാനക്കെ തലെബാഗി കൈയമുഗിദു
    ബേഡുവ ഭക്തരിഗെ നീ ദയാ സിംധു ||൧||
    ഏളേളു ലോകദ അനു അനുദിനാ
    ഇഹപരദ സാധനകെ നീ കാരണ
    നിന്നൊലുമെ നോടദ ഒംദു ഹൊന്നകിരണ
    നീഡിദരെ സാകയ്യ ജനുമ പാവന ||൨||
    പാര്വതീ പരശിവന പ്രേമ പുത്രനെ
    പാലിസുവ പരദൈവ ബേരെ കാണെ
    പാപദ പംകദലി പദുമ എനിസു എന്ന
    പാദ സേവ ഒംദേ ധര്മ സാധന ||൩||

    N.B: please feed back any corrections and omissions to improve the Lyrics

    Reply

  27. Posted by JYOTHIKA.U. on August 22, 2017 at 7:33 am

    I WANT THIS SONG GAJA MUKHANE GANAPATHIYE IN MALAYALAM

    Reply

  28. Posted by Krishna on August 12, 2017 at 1:26 pm

    Very nice blog. Happy to stumble into it. Could you please post the lyrics and meaning of the song “Aidu kaalina mancha” ? Many thanks

    Reply

  29. Posted by arisish on August 8, 2017 at 3:19 am

    madam can you please post lyrics to a song called “muttina ungara sri rama kotta hanumage” its an old song my grandmother used to sing and I can’t find it anywhere else. Thank you.

    Reply

  30. Posted by Vidya Rao on July 16, 2017 at 3:01 am

    ಸ್ಮರಿಸು ಗುರುಗಳ ಮನವೇ ಸ್ಮರಿಸು….ಈ ಹಾಡಿನ ಸಾಹಿತ್ಯ ಇಲ್ಲಿ ಕಳುಹಿಸಿ pls

    Reply

  31. Posted by Sachin Valsangkar on July 14, 2017 at 7:58 am

    Hi, if you have the lyrics of the below song by Vadirajaru, please share:

    “Indire madiradolage nindire”

    Reply

    • Posted by Lakshman on August 10, 2017 at 5:28 pm

      I have two versions:
      indirE mandiradoLu (1). no given rAgA or tALA. Vadirajasvami.

      P: indire mandiradoLu nindire indira deviye ninna pAda nambide salaha bekenna
      C1: ahA gandha tulasi aravinda mallige puSpadinda pUjisuvenu kundugaLeNisade ghalu ghalu
      gejjeyanadadinda bhali bhalisuva celvapAda divya pilya kAlunguranAdAnghri calisuva divya puSpapAda
      2: ahA kAlalanduge gejjejulipusuttale namma Alayadalli nille pAlavAridhikanye haradi kanka
      vankidvAryaa koralollidha nAnAvidhadahAra bAlyoliha karpUradvIlyasAra nala surabhi campaka puSpahAra
      3: AhA yeralegangale siri kumkuma aralele heralu gUndyAdinda
      hariya mohisuve nI indira devi nirbhIta shatAnanda devarigatiprIte
      shrI mukundana kathAmruta jAte kunda mandamAla virajIte
      4: AhA mandaroddharaNa govindana rAni ninna caraNAravindava pUjisuve
      uttadatteya nere valipu nadu valitta kinkini patti jhulapu bahu batta
      kuchaagrada kadapu totta ghatti kancukashere golipu
      5: AhA kantadindolevantha kantE mangalaso otra kantE kantErava koti sUryana kAnte jaya jaya
      vijaya sampUrNe bhakta bhayanivAraNeya guNamaNiye yenna kAyuvaranyAra kANe sheSashayananna
      tore sushrUni AhA kaiya mugive bhava bhayava harisenna siri hayavadanana dayavu pAlise lakshmI

      indire mandiradoLu (2). no given rAgA or tALA. Vadirajasvami.

      P: indire mandiradoLu nindire indire hondide ninna mudadinda pAlisu nitya enna AhA
      C1: gandha tuLasi aravinda mallige puSpadinda pUjisuvenu kundugaLeNisade
      ghalu ghalu gejjeya nAdadinda phaLaphaLisuva divyapAdadoLu pilya kAlunguranAda anghri
      calisuva divyasusvAda AhA kAlalandige gejje jhaLapisutta nammAlayadoLu nille pAlavAridhikanne|
      2: haraDi kankaNa vanki dhOrya koraLoLage nAnA vidhadhAra bAyaliruvO karpUra vILya
      sAre surabhi nAsika campaka puSpakhAra AhA eraLegangaLe siri araLele kumkuma
      heraLagoNDegaLinda hariya mOdisuve
      3: jayajaya vijayasampUrNe bhakta bhayanivAraNe eNegANe enna
      kAyuvaranyara kANe shESa shayananna tOre sushrENe AhA kaiya piDidu
      bhavabhayava pariharise siri hayavadanana dayava pAlise lakSmI

      Reply

  32. Posted by Sulakshana on June 9, 2017 at 4:56 am

    Hello Meera , feels happy to visit your website. We get lots of information . Since many days I am searching for a song but didn’t find anywhere. I searched even your website but no. Lyrics of the song is ‘Ishtu daya madide ati sojiga, srushtesta dayakane brahshta manavanalli ‘. Please if you find send to my mailbox. I frequently visit your site. Thank you for such a informative site.

    Reply

    • Posted by meeraghu on June 9, 2017 at 4:56 pm

      Sure.

      Reply

      • Posted by Lakshman on June 30, 2017 at 1:13 pm

        racane: sarasvati bAyi

        iShTu daya mADidde ati sOjiga
        shiShTEShTadAta bhraShTa mAnavanalli /pa/

        udayakAladaleddu padumasaMbhava pitana
        vadanadali neneyadale mAniniyara
        caduratege meccutale udara poredana mEle
        cadura shrIkRuShNa badiganAgiddu /1/

        karuNAsamudrana smaraNe sAlade eMba
        parama gurugaLa vacana maretu ninna
        smarisadale nirutadi parara bAgiligOgi
        caraNa daNiyuta manadi marugidanO kRuShNA /2/

        innAdarenna manadi pannagAdri nivAsa
        ninna smaraNeya koTTu mannisenna
        Gana aparAdhagaLa varNisalaLavalla
        cenniga shrI shrInivAsa Gana saMpanna sariyArO /3/

  33. Posted by Rani Harish on May 24, 2017 at 1:26 pm

    I want durga suladi in Tamil. Where do I find it.

    Reply

  34. Posted by P.S.Thammanna on May 9, 2017 at 10:39 pm

    ನರಸಿಂಹ ಗೀತೆ ಎಂದರೇನು?

    Reply

  35. Posted by Vidya Rao on May 9, 2017 at 10:58 am

    ನಮಸ್ತೆ
    ನರಸಿಂಹ ಗೀತೆಯ ಸಾಹಿತ್ಯ ಇಲ್ಲಿ ಒದಗಿಸಲಾಗುವುದೇ.
    ಧನ್ಯವಾದಗಳು ಈ ಮೇಲಿನ ಎಲ್ಲಾ ದೇವರ ಸ್ತೋತ್ರಗಳಿಗೆ.

    Reply

  36. Posted by P.S.Thammanna on May 4, 2017 at 7:37 am

    ಯೋಗಿ ಮನೆಗೆ ಬಂದ | ಶ್ರೀಗುರುದೇವ ಮನೆಗೆ ಬಂದ |
    ಕಾಲಲಿ ಪಾದುಕ ಕೈಯಲಿ ದಂಡ
    ಬಾಲರವಿಯ ಕಳೆಯ |…..(೨ ) ||ಯೋಗಿ||

    ಮಸ್ತಕದಲಿ ಜಟೆ ಶೋಭಿಸುತಲ್ಲಿ |
    ಕಸ್ತೂರಿ ತಿಲಕ ಚಂದನ ಹಣೆಯಲ್ಲಿ
    ವಿಸ್ತರ ನಗುಮುಖದ |…..(೨) ||ಯೋಗಿ||

    ಜೋಲುತಿರಲು ಕೊರಳೊಳು ರುದ್ರಾಕ್ಷ |
    ಜೋಳಿಗೆ ಬಗಲಲಿ ತ್ರಿಲೋಕ ರಕ್ಷ
    ಕಾಷಾಯಾಂಬರದ |…..(೨) ||ಯೋಗಿ||

    ಕುರುದ್ವೀಪದ ಕೃಷ್ಣೆಯ ತಟದಲ್ಲಿ |
    ಸರಸದಿ ವಾಸಿಪ ಶ್ರೀಪಾದಯೋಗಿ
    ಪರಮಪುರುಷ ನೃಹರಿ |…..(೨)||ಯೋಗಿ||

    ಭಕ್ತಕಾಮ ಕಲ್ಪದೃಮನೀತ |
    ನಿತ್ಯಪೂರ್ಣ ಸಚ್ಚಿದಾತ್ಮ ದತ್ತ
    ಶಂಕರ ಗುರುರೂಪ |…..(೨ ) ||ಯೋಗಿ||
    ೧೨
    N.B: ಪಾಠಾಂತರಗಳಿರಬಹುದು, ನನಗೂ ತಿಳಿಸಿ. ಅದನ್ನೂ ನನ್ನ ಪಠ್ಯದಲ್ಲಿ ಸೇರಿಸಿಟ್ಟಿರುತ್ತೇನೆ.

    Reply

  37. Posted by Rakesh on May 2, 2017 at 1:50 am

    Please add lyrics for “yogi manege Banda” song

    Reply

  38. Posted by Lakshman on April 11, 2017 at 9:53 pm

    Raghavendra Rao: If you can understand Kannada, please listen to the song here and figure out the lyrics:

    http://mio.to/album/Anantha+Kulkarni/Yenu+Saviyo+Ninna+Kolalu

    Reply

  39. Posted by P.S.Thammanna on April 11, 2017 at 3:34 am

    രാഗ: കേദാരഗൗള – താള: ഛാപുതാള
    ൧൪൧. ഏതര ചലുവ രംഗയ്യ ||പ || ഹരിയെംബ മാതിഗെ മരുളാദെനല്ലദെ ||അ|| ദേശകോശഗളുള്ളൊഡെ താ ക്ഷീരദ | രാശിയൊളഗെ മനെ കട്ടുവനെ | ഹാസുവുദക്കെ ഹാസിഗെയുള്ളൊഡെ താ ശേഷ ബെന്നാല മലഗുവനെ രംഗ ||൧|| ബുദ്ധിയ പേളുവ പിതനുള്ളൊഡെ ബെണ്ണെ | കദ്ദു ചോരനെനെംദെസുവനെ രംഗ ||൨|| ഹഡെദ തായി തനഗുള്ളൊഡെ ഗോപുര | ഒളഗുഡി തുരുവിംഡ കായുവനെ | മഡദിയു ഉള്ളൊഡെ അഡവിയൊളാഡുവ | ഹുഡുഗിയര സംഗ മാഡുവനേ |രംഗ ||൩|| സംഗഡ ഉദിസിദ ആണ്ണനിദ്ദരെ നര | സിംഗന രൂപവ ധരിസുവനെ | അംഗദ മേലെ ആസെയിദ്ദൊഡെ | കാളിംഗന മഡുവലി ധുമുകുവനേ | രംഗ ||൪|| സതിയുള്ളൊഡെ രക്ഷപതിയെഡെഗൈദി താ | ക്ഷിതിയ ദാനവ ബേഡുവനെ | മതിവംത പുരംദര വിഠലരായന | പതിതപാവനനെംദു നുതിസിദെനല്ലദെ ||൫|| (%)

    rAga: kEdAragauLa – tALa: CAputALa
    141. Etara caluva raMgayya ||pa || hariyeMba mAtige maruLAdenallade ||a|| dEshakOshagaLuLLoDe tA kShIrada | rAshiyoLage mane kaTTuvane | hAsuvudakke hAsigeyuLLoDe tA shESha bennAla malaguvane raMga ||1|| buddhiya pELuva pitanuLLoDe beNNe | kaddu cOraneneMdesuvane raMga ||2|| haDeda tAyi tanaguLLoDe gOpura | oLaguDi turuviMDa kAyuvane | maDadiyu uLLoDe aDaviyoLADuva | huDugiyara saMga mADuvanE |raMga ||3|| saMgaDa udisida ANNaniddare nara | siMgana rUpava dharisuvane | aMgada mEle AseyiddoDe | kALiMgana maDuvali dhumukuvanE | raMga ||4|| satiyuLLoDe rakShapatiyeDegaidi tA | kShitiya dAnava bEDuvane | mativaMta puraMdara viThalarAyana | patitapAvananeMdu nutisidenallade ||5|| (%)

    Is this one you are looking Mr. Hariharan? Tala is mentioned as Chapu!
    P.S.Thammanna from Bangalore on April 11 th.

    Reply

  40. Posted by Hariharan G on April 6, 2017 at 1:31 pm

    Etara cheluva rangayya (Purandara dasa)
    Kedaragaula
    Adi
    Please send Lyrics in English or MalayalamL

    Reply

  41. Posted by Raghavendra Rao on April 6, 2017 at 1:10 pm

    I need lyrics of Kannada devotional song Yentha srimantha Ananthano by Sri Prasanna venkata dasaru.

    Reply

  42. Posted by Raghavendra Rao on April 6, 2017 at 12:55 pm

    I have been searching lyrics of song ” Yentha Srimantha ananthano” by Sri Prasanna venkata dasaru but not succeeded. Can you kindly send me the required lyrics ?
    Thank you
    With good wishes
    Raghavendra Rao

    Reply

  43. Posted by Prakash S Belur on February 6, 2017 at 6:25 pm

    Thank you very much for the lyrics.

    Reply

  44. Posted by P.S.Thammanna on February 6, 2017 at 8:34 am

    ರಾಗ: ಹಮೀರ್ ಕಲ್ಯಾಣಿ- ಖಂಡಚಾಪುತಾಳ
    ನಾ ಸ್ತೋತ್ರವಾ ಗೈವೆ ಶ್ರೀ ಶಾರದಾಂಬೆಯನು | ದಾಸಾನುದಾಸರಿಗೆ ಲೇಸೆನಿಸಿ ಪೊರೆಯೆಂದು ||ಪ|| ಕರದಲ್ಲಿ ವೀಣೆಯನು ಧರಿಸುತ್ತ ದ್ವನಿಮಾಡಿ | ಅರಿವೆಂಬೋ ಅಮೃತವನು ಸುರನರರಿಗೀಯುವಳೆ ||೧|| ಚರಣಕ್ಕೆ ನಾ ನಮಿಪೆ ಸರಸ್ವತಿಯೆ ಗೀರ್ವಾಣಿ | ಹರಿಸೆಮ್ಮ ದುಃಖಗಳ ಪೊರೆಯೆಂದು ಬೇಡುತ್ತಾ ||೨|| ವೇದಾದಿ ವಿದ್ಯಗಳ ಅಧಿದೇವತೆಯು ನೀನು | ಅಜ್ಞಾನ ಪರಿಹರಿಸಿ ಸುಜ್ಞಾನವನು ನೀಡು ||೩||

    Reply

  45. Posted by Prakash S Belur on February 5, 2017 at 11:08 pm

    Dear Friends, Could you research lyrics on “Sharada or Saraswathi” prayer

    “naa stotra vaa gaive shri shaaradaambeyanu, karadalli veeneyanu nudisoottha dwani maadi” .
    it goes by these lines. But I want the full lyrics. I am pondering over this for quite a long time. I heard this from my mother and sister.

    Reply

  46. Posted by aryambal on February 3, 2017 at 10:44 am

    Namaste!
    I have a copy of Sathyanarayana kathas in Sanskrit. It is short and more presentable. I can post it if you please.
    VJ

    Reply

  47. Posted by H Narayanaswamy on January 26, 2017 at 11:17 pm

    I need ಕಾಮದೇನು ಪೂಜ (ಗೂ ಮಾತಾ ಪೂಜೆ)ವೀದಾನ and ಮಹತ್ವಾ importance of cow pooja in Kannada

    Reply

  48. Posted by Adarsha on January 26, 2017 at 10:20 pm

    tAyi endaru nInE bandu baLagavu ellA nInE tAyE–ninna biTTare anage anya daivava kANe.
    Madam pls pls send me the lyrics for the above I am searching for this from many days I will be very thankful if you send it to me thank you. Adarsh

    Reply

    • Posted by Lakshman on January 30, 2017 at 1:14 pm

      I had posted a song with these words in NOvember 2016. Is this the song you are looking for?
      P: nUru yOjana virali nA hAri baruvEnu tAyE ninna padavE enage sharaNu sharaNu–sharaNu sharaNu
      A: ninna kangaLa kAnti –enna hrdayake shAnti–ninna mandasmitavE manada haruSA
      C: tandE endaru nInE tAyi endaru nInE bandu baLagavu ellA nInE tAyE–ninna biTTare anage anya daivava kANe
      namO namO jaganmAtE O shakti dAtE namO namo jaganmAtE O mukti dAtE

      Reply

  49. Posted by Lakshman on December 24, 2016 at 5:10 pm

    Corrections welcome:

    lOka vIram mahA pUjyam, sarvarakSakaram vibhum !
    pArvati hrdayAnandam, shAstAram praNamAmyaham !!
    svAmiyE sharaNam ayyappA !! 1 !!

    viprapUjyam vishvavandyam, viSNu shambhO priyam sutam !
    kSipra prasAda niratam, shAstAram praNamAmyaham
    svAmiyE sharaNam ayyappA !! 2 !!

    matta mAtanga gamanam, kAruNyAmrta pUritam !
    sarva vighnaharam dEvam, SshAstAram praNamAmyaham !!
    svAmiyE sharaNam ayyappA !! 3 !!

    asmatkulEshvaram dEvam, asmat shatru vinAshanam !
    asmadiSTa pradAtaram, shAstAram praNamAmyaham !!
    svAmiyE sharaNam ayyappA !! 4 !!

    pANDyEsha vamsha tilakam, kEraLE kELi vigraham !
    Arta trANa param dEvam, shAstAram praNamAmyaham !!
    svAmiyE sharaNam ayyappA !! 5 !!

    panca ratnAkya mEtadyO nityam shuddha patennaraha !
    tasya prasanno bhagavAn shAstA vasati mAnasE !!
    svAmiyE sharaNam ayyappA !! 6 !!

    shabarigiri nivAsam shAnta hrd padma hamsam !
    shashi ruci mrtuhAsam shyAmalam bOodha bhAsam !!
    kalita ripu nirAsam kAnta mrtunga nAsam !!
    natinuti paradAsam naumi pinjAvatamsham !!
    svAmiyE sharaNam ayyappA !! 7 !!

    shabarigiri nishAntam shange kundentu dantam !
    shamadana hrdi bhAntam shatru pAlE krtAntam !!
    sarasija ripukAntam sAnu kampEksha nAntam
    krta nuta vipadantam kIrtayEham nitAntam !!
    svAmiyE sharaNam ayyappA !! 8 !!

    shabarigiri kalApam shAstra vadhvAnta dIpam
    shamita sujana tApam shantihIr nir dhurApam !
    kara dhrta sumacApam kAraNO pAta rUpam !
    kaca kalitha kalApam kAmayE puSkalabam !!
    svAmiyE sharaNam ayyappA !! 9 !!

    sabarigiri nikEtam shankarOpEndrapOtam
    shakalita dhitijAtam shatruji mUtapAtam !
    padanata puruhUtam pAlita sheSa bhUtam
    bhavajalanidhi bhOtam bhAvayE nitye bhUtam !!
    svAmiyE sharaNam ayyappA !! 10 !!

    shabari vihriti lOkam shyamalOddhAra cElam
    shatamaka ripukAlam sarva vaikuNTha balam !
    natajana surajAlam nAki lOkAnukUlam
    navamayamaNi mAlam naumi nisshESa mUlam !!
    svAmiyE sharaNam ayyappA !! 11 !!

    shabarigiri kuTIram shatru sanghAta ghOram
    shatagiri shatadhAram shashpi tEndrAri shUram !!
    hari girIsha kumAram hAri kEyura hAram
    navajaladha sharIram naumi vishvaika vIram !!
    svAmiyE sharaNam ayyappA !! 12 !!

    SsarasijadaLa nEtram sAra sArAti vaktram
    sajala jaladha gAtram sAndra kAruNya pAtram !
    saha tanaya kaLantram sAmba gOvinda putram
    sakala vibhudha mitram sannamam pavihram !!
    svAmiyE sharaNam ayyappA !! 13 !!

    shridAnanda cintAmaNi shrInivAsam
    sadA saccidAnanda pUrNa prakAsham !
    UdhAram sadhAram surAdhAra mIsham
    paramjyOti rUpam bhajE bhUthanAtham !!
    svAmiyE sharaNam ayyappA !! 14 !!

    vibhum vEda vEdAnta vEdyam variSTam
    vibhUti pradam vishrutam brahma niSTam
    vibhAsvat-prabhAva prabhum puSka lESTam
    paramjyOti rUpam bhajE bhUtanAtham !!
    svAmiyE sharaNam ayyappA !! 15 !!

    paritrANa dakSam parabrahma sUtram
    surascAru gAtram bhavadhvAnta mitram!
    param prEma pAtram pavitram vicitram
    paramjyoti rUpam bhajE bhUtanAtham !!
    svAmiyE sharaNam ayyappA !! 16 !!

    parEsham prabhum pUrNa kAruNya rUpam
    girIshAdi pIThOjvala cArudIpam !
    sureshAdi samsEvitam supratApam
    paramjyOti rUpam bhajE bhUtanAtham !!
    svAmiyE sharaNam ayyappA !! 17 !!

    gurum pUrNa lAvaNya pAdadi kEsham
    garIyam mahatkOTi sUrya prakAsham !
    karAmbhOru hanya sthavEtram surEsham
    paramjyOti rUpam bhajE bhUthanAtham !!
    svAmiyE sharaNam ayyappA !! 18 !!

    harIshAna samyukta shaktyEka vIram
    kirAtAva tAram kripApAnga pUram !
    kirITAvat sojjvalat pinjca bhAram
    paramjyOti rUpam bhajE bhUthanAtham!!
    svAmiyE sharaNam ayyappA !! 19 !!

    mahAyOga pIThOjvalantam mahAntam
    mahAvAkya sArOpadEsham sushAntam!
    maharSi praharSa pradam jnAna kAntam
    paramjyOti rUpam bhajE bhUtanAtham !!
    svAmiyE sharaNam ayyappA !! 20 !!

    Reply

  50. Posted by Prashanth Devadiga on December 22, 2016 at 1:16 am

    Meera Madam.

    Could you please send Ayyappa swamy stortram and songs in kannada Lyrics ???

    Reply

  51. Posted by Lakshman on December 19, 2016 at 2:21 pm

    Kumar: If you send me a message to luzchurch@gmail.com I can send you the scanned page of the song.

    Reply

  52. Posted by P.S.Thammanna on December 16, 2016 at 10:16 pm

    Here is Tamil version of mosa hodenalla. as required by Kumar:

    ராக: தன்யாஸி – தாள: ஆதிதாள

    மோஸ ஹோதெனல்லா | திளியதெ மோஸ ஹோதெனல்லா ||ப||

    க்லேஶபாஶவனு னாஶமாடுவ
    ஶ்ரீஶனம்க்ரிகள லேஸாகி ஸ்மரிஸதெ ||அப||

    காயதாஶெயிம்த கம்டத்து பேடி ஶ்வானனம்தெ
    மாயபாஶதலி ஸிலுகி ரமாரமணனெ னின்ன த்யானவ மாடதெ ||௧||

    புஷ்ப ஜாஜிகளனு மல்லிகெ பக்தி பாவதிம்த தம்து
    க்றுஷ்ணாவதாரன பூஜெய மாடி விஷ்ணுலோகவனு ஸூரெகொள்ளதெ ||௨||

    ஸதிஸுதாதி பம்து பளக ஹிதவ னுடிவர்யாரோ
    கதி னீனெ தம்தெ தாயி னீனெ ஸத்கதி ஈயோ புரம்தர விடல ||௩||

    Reply

  53. Posted by kumar on December 16, 2016 at 3:56 pm

    I WISH TO GET THE SONG mosa hoda nallo IN TAMIL LYRICS. PL. HELP

    Reply

  54. these are the wonderful devotional songs which i heard from my mother for which i could not get the Lyrics any where
    Kindly share it if any of you have.
    1. Mahime peluve pelire ejagadodayana Mahime peluve pelire:

    this song completely contains story of Lord Satyanarayana vratha
    2. Hariavatharisida Dhareyolage, Soundaryanari Vasudevaniralu, Bandhana bedesi Bakhtara Poreuve mandharodharaavatahrisida-

    This is song on Lord krishna that describes how krishna was born and rescue his parents from jail, in the same way he has to release us from samsara bandhana

    Reply

  55. Posted by Jayanthi Pranesh kumar on December 14, 2016 at 11:29 pm

    Madam,I want the meaning of the shloka sri Krishna sharanam mama
    This is sri haridasa virachita sri Krishna shranashtaka

    Reply

  56. Devotional songs of shiva parijatha lyrics

    Reply

  57. Posted by Lakshmi on November 30, 2016 at 11:31 am

    Dear Meera
    To me, this is one of the rare songs of Purandaradasa
    Raaga Revagupti Taala Adi

    ಪೂಲ ಚೆಂಡಾಡಿದನೇ ಶ್ರೀ ಕೃಷ್ಣಾ
    ಪೂಲ ಚೆಂಡಾಡಿದನೇ ಶ್ರೀ ಕೃಷ್ಣಾ
    anupallavi
    ಪೂಲ ಚೆಂಡಾಡಿದ ಪುಷ್ಪ ಚೆಂಡಾಡಿದ
    ಲಕ್ಷ್ಮೀ ರಮಣ ಪುಷ್ಪ ಚೆಂಡಾಡಿದ
    charana
    ಪುಂಡರೀಕಾಕ್ಷ ಪುರುಷೋತ್ತಮಾ
    ಹರಿ ಗುಂಡು ಮುತ್ತಿನ ಚೆಂಡಾಡಿದ
    ಅಂಡಜ ವಾಹನ ಅಮರೇಂದ್ರ ವಂದ್ಯನಾ
    ಪುರಂದರ ವಿಠಲ ಪುಷ್ಪ ಚೆಂಡಾಡಿದ ಶ್ರೀ ಕೃಷ್ಣ

    Pula chendaadidane Sri Krishna
    Pula chendaadidane Sri Krishna

    Anupallavi
    Pula chendaadida pushpa chendaadida
    Lakshmi Ramana pushpa chendaadida
    Charana
    Pundarikaksa purusottama
    Hari gundu muttina cendaadida
    Andaja vaahana amarendra vandyanaa
    Purandara Vittala pushpa chendaadida sri Krishna

    If possible to post my singing, I can do that – not a good singer but will get the idea how the song goes
    Thank you

    Reply

  58. Posted by P.S.Thammanna on November 30, 2016 at 5:40 am

    Recently Tulasi puja was celebrated. I felt this kRuti will be of interest to most of visitors to this blog. It goes like…..

    ವೃಂದಾವನವೇ ಮಂದಿರವಾಗಿಹ ಇಂದಿರೆ ಶ್ರೀ ತುಳಸಿ

    ರಾಗ: ಸೌರಾಷ್ಟ್ರ ತಾಳ: ಛಾಪು

    ವೃಂದಾವನವೇ ಮಂದಿರವಾಗಿಹ ಇಂದಿರೆ ಶ್ರೀ ತುಳಸಿ ||ಪ||

    ನಂದನಂದನ ಮುಕುಂದಗೆ ಪ್ರಿಯಳಾದ ಚಂದದ ಶ್ರೀ ತುಳಸಿ ||ಅಪ||

    ತುಳಸಿವನದಲಿ ಹರಿ ಇಹನೆಂಬುದ ಶ್ರುತಿ ಸಾರುತಿದೆ ಕೇಳಿ
    ತುಳಸಿ ದರ್ಶನದಿಂದ ದುರಿತಗಳೆಲ್ಲವು ದೂರವಾಗುವುವು ಕೇಳಿ
    ತುಳಸಿ ಸ್ಪರ್ಶವ ಮಾಡೆ ದೇಹ ಪಾವನವೆಂದು ತಿಳಿದುದಿಲ್ಲವೆ ಪೇಳಿ
    ತುಳಸಿ ಸ್ಮರಣೆ ಮಾಡಿ ಸಕಲೇಷ್ಟವ ಪಡೆದು ಸುಖದಲಿ ನೀವು ಬಾಳಿ ||೧||

    ಮೂಲಮೃತ್ತಿಕೆಯನು ಮುಖದಲಿ ಧರಿಸಲು ಮೂರ್ಲೋಕವಶವಹುದು
    ಮಾಲೆ ಕೊರಳಲಿಟ್ಟ ಮನುಜಗೆ ಮುಕ್ತಿಯ ಮಾರ್ಗವು ತೋರುವುದು
    ಕಾಲಕಾಲಗಳಲ್ಲಿ ಮಾಡುವ ದುಷ್ಕರ್ಮ ಕಳೆದು ಬಿಸಾಡುವುದು
    ಕಾಲನ ದೂತರ ಕಳಚಿ ಕೈವಲ್ಯದ ಲೀಲೆಯ ತೋರುವುದು ||೨||

    ಧರೆಯೊಳು ಸುಜನರ ಮರೆಯದೆ ಸಲಹುವ ವರಲಕ್ಷ್ಮಿ ಶ್ರೀ ತುಳಸಿ
    ಪರಮಭಕ್ತರ ಘೋರ ಪಾಪಗಳನು ತರಿದು ಪಾವನಮಾಡುವ ತುಳಸಿ
    ಸಿರಿ ಆಯು ಪುತ್ರಾದಿ ಸಂಪದಗಳನಿತ್ತು ಹರುಷಗೊಳಿಪ ತುಳಸಿ
    ಪುರಂದರವಿಠಲನ ಚರಣ ಕಮಲಗಳ ಸ್ಮರಣೆ ಕೊಡುವ ತುಳಸಿ ||೩||

    Reply

  59. Posted by P.S.Thammanna on November 25, 2016 at 5:42 am

    ಹರಿಯೇ ಸರ್ವೋತ್ತಮ

    ರಾಗ: ಸಾವೇರಿ ತಾಳ: ಝಂಪೆ
    ಹರಿಯೇ ಸರ್ವೋತ್ತಮ ಹರಿಯೇ ಪರದೇವತೆ
    ಹರಿ ಸರ್ವ ವಿಶ್ವಮಯಂ ಜಗತು ||ಪ||

    ಹರಿಯಲ್ಲದನ್ಯತ್ರ ದೈವಂಗಳಿಲ್ಲವೆಂದು
    ಉರಗನ ಹೆಡೆಯನ್ನು ಪಿಡಿದು ಹೇಳುವೆನಯ್ಯ ||ಅಪ||

    ಜಗವ ಪುಟ್ಟಿಸುವ ಬ್ರಹ್ಮ ನಿನ್ನ ಮಗ
    ಜಗವ ಸಂಹರಿಸುವ ರುದ್ರ ನಿನ್ನ ಮೊಮ್ಮಗನು
    ಜಗದ ಪಾವನೆ ಭಾಗೀರಥಿ ನಿನ್ನ ಮಗಳಯ್ಯ
    ಜಗದ ಜೀವರ ಮಾತೆ ನಿನ್ನರಸಿಯೊ ದೇವ ||೧||

    ವಿಶ್ವತೋಮುಖ ನೀನೇ ವಿಶ್ವತಶ್ಚಕ್ಷು ನೀನೆ
    ವಿಶ್ವತೋಬಾಹು ವಿಶ್ವಪಾದನು ನೀನೆ
    ವಿಶ್ವ‍ಉದರ ನೀನೇ ವಿಶ್ವವ್ಯಾಪಕ ನೀನೆ
    ವಿಶ್ವನಾಟಕ ಸೂತ್ರಧಾರಿಯೆ ವಿಷ್ಣುವೆ ||೨||

    ಆಗಮ ನಿಗಮ ಪುರಾಣಶಾಸ್ತ್ರಂಗಳಲ್ಲಿ
    ಯೋಗಿಗಳರಸಿ ನಿಮ್ಮ ಕಾಣದಿಪ್ಪರೊ
    ನಾಗಶಯನ ಭೋಗಿ ಭೂಷಣವಂದಿತ
    ಭಾಗವತ ಪ್ರಿಯ ಶ್ರೀ ಪುರಂದರವಿಠಲ ||೩||

    hariyE sarvOttama hariyE paradEvate
    hari sarva vishvamayaM jagatu ||pa||

    hariyalladanyatra daivaMgaLillaveMdu
    uragana heDeyannu piDidu hELuvenayya ||apa||

    jagava puTTisuva brahma ninna maga
    jagava saMharisuva rudra ninna mommaganu
    jagada pAvane bhAgIrathi ninna magaLayya
    jagada jIvara mAte ninnarasiyo dEva ||1||

    vishvatOmuKa nInE vishvatashcakShu nIne
    vishvatObAhu vishvapAdanu nIne
    vishva udara vishvavyApaka nIne
    vishvanATaka sUtradhAriye viShNuve ||2||

    Agama nigama purANashAstraMgaLalli
    yOgigaLarasi nimma kANadipparo
    nAgashayana bhOgi bhUShaNavaMdita
    bhAgavata priya shrI puraMdaraviThala ||3||
    ಈ ಕೀರ್ತನೆಯನ್ನು “ಪುರಂದರ ದಾಸರ ಜನಪ್ರಿಯ ಕೀರ್ತನೆಗಳು” ಎಂಬ, ಡಾ. ಶ್ರೀನಿವಾಸ ಹಾವನೂರು ಮತ್ತು ಹೊ. ರಾ. ಸತ್ಯನಾರಾಯಣರಾಯರಿಂದ ಸಂಪಾದಿಸಲ್ಪಟ್ಟ ಪುಸ್ತಕದಿಂದ ಆರಿಸಿದೆ.

    Reply

  60. Posted by Praveen V on November 25, 2016 at 2:58 am

    Please,upload Sri venkata stavsraja

    Reply

  61. Posted by P.S.Thammanna on November 21, 2016 at 9:26 am

    Apart from spelling mistakes the text is different from that given in “puraMdaradAsara janapriya kIrtanegaLu” by Dr..srInivAsa hAvanUr & H.R. satyanArAyaNarAv.. Please post as sent by me on 17-11-16

    Reply

  62. Posted by Lakshman on November 18, 2016 at 4:10 pm

    corrections welcome:
    hariyE sarvOttama. rAgA: sAvEri. jhampe tALA. Purandaradasa.

    P: hariyE sarvOttama hariye para dEvate hariyalladanyatra
    daivagaLuNTendu uragana muNDigen yArAdarettali
    C1: vishvadash-cakSu nInE vishvatOmukha nInE vishvatO bAhu vishvadudara nInE
    vishva vyApaka vishva sUtradhara nInE vishva nATaka shrI viSNuvE namO namO
    2: jagangaLa srujisuva bomma ninna maga jagangaLa pAvane ninna sute
    jagangala jIvani rANi mahAlakSmi jagava mOhisudirpa mAye maneya tottu
    3: Agama nigama purANa shAstrangaLalli yOgigaLarasi nimma kANadipparo
    nAgashayana bhujanga bhUSaNa vandita bhAgavata priya purandara viTTala

    Reply

  63. Posted by P.S.Thammanna on November 17, 2016 at 4:15 am

    Purandaradasara kirthane;
    “Hariye sarvothama hariye paradivau
    Hari sarvam vishnu mayam” This kirthane has been sent separately by mail for posting in blog please.

    Reply

  64. Posted by indu on November 14, 2016 at 5:53 am

    Namaskara,
    Your blog is superb. Can I request you to add this song and its complete lyrics from Purandaradasara Padagalu:
    “Hariye sarvothama hariye paradivau
    Hari sarvam vishnu mayam”

    Reply

    • Posted by thammanna_ynk@yahoo.com on November 17, 2016 at 2:30 am

      NamaskaraSome one had asked the hariyE sarvottama kIrtana. As I could not post in the blog,It  attached herewith for necessary posting in blog for their convenience.RgdsP.S.T

      Reply

  65. Posted by P.S.Thammanna on November 12, 2016 at 12:03 am

    With reference to my posting (Posted by thammanna_ynk@yahoo.com on November 5, 2016 at 3:19 am). The transliterated files have been sent to Mr. Lakshman and he is satisfied with the 45 numbers of Shri Vadirajaru keertanas..For information please.

    Reply

  66. Posted by Lakshman on November 6, 2016 at 10:02 pm

    P: nUru yOjana virali nA hAri baruvEnu tAyE ninna padavE enage sharaNu sharaNu–sharaNu sharaNu
    A: ninna kangaLa kAnti –enna hrdayake shAnti–ninna mandasmitavE manada haruSA
    C: tandE endaru nInE tAyi endaru nInE bandu baLagavu ellA nInE tAyE–ninna biTTare anage anya daivava kANe
    namO namO jaganmAtE O shakti dAtE namO namo jaganmAtE O mukti dAtE

    Reply

  67. Posted by Adarsha on November 5, 2016 at 12:47 am

    Can you send me this song and lyrics “NOORU YOJANAVIRALI NAA HAARIBARUVENU THAAYE NINNA PAADAVE YENAGE SHARANU SHARANU” i do not know the complete song but it’s beautiful pls if you have this kindly forward. Thanks

    Reply

  68. Posted by Lakshman on October 26, 2016 at 7:18 pm

    Meera: : It is almost the end of October. Hopefully you will have time to transliterate the songs that I had requested last month. Thanks.

    Reply

    • Posted by meeraghu on October 28, 2016 at 1:40 pm

      Not going to have any time until December Lakshman. My job is usually very hectic end of year.

      Reply

      • Posted by thammanna_ynk@yahoo.com on November 5, 2016 at 3:19 am

        Shrimati Meera avarige namaskaragaLuAs required by Shri Lakshman, the VAdirAja ThIrtha’s Kruties taken from Sode shri MaTha Web site  is transliterated to English and is enclosed for you posting as may be required.Please feel free to ask for doing corrections if any.I trust this will be of help to you in your work.NamaskaragaluP.S.T

  69. Posted by Smitha P on October 14, 2016 at 11:52 am

    Meera avarige nanna savinaya vandane,

    Nimma Blog nanage tumba acchu mechhu, naanu esto daivika sampradaya vichara galannu illi kalithidini, nanage bekada halavu vichara, haadu, aduge, sampradayika chintane galu e blog nalli dorakive. Nimma dhaarmika sevege namma hrutpurvaka vandanegalu madam.

    thanks for all your seva, n thoughtful blog

    Smitha

    Reply

  70. Posted by Anuradha on October 5, 2016 at 5:19 am

    HI,

    I am searching for the lyrics of ” Kailasa vasa Gaurisha EEsha ” in Kannada Script. Can you please arrange for it.

    Thanking you in advance.

    Reply

    • Posted by Roopa Pai on October 13, 2016 at 1:37 pm

      Hi Meera, If possible could u please sent me the lyrics of below bhajan in English 1,jai jai jai Maatha sharada 2,Anjaneya bala bheema ,jai jai hanuman 3,Bandanode bandenode mandiradolu

      Thanks

      Reply

  71. Posted by P.S.T on September 17, 2016 at 9:49 am

    I could not post a kannada song (Puranadara dasa kirtane, buddhi matu helidare) as asked by one M/s Sudha. What is the way out? Is there any E-mail address so that I can send the file in PDF so that the same can be posted.

    Reply

  72. Posted by P.S.T on September 17, 2016 at 9:44 am

    I could not post some kannada purandaradasa kirtane (buddhi mAtu hELidare) as asked by one M/s. Sudha .here. What is the way out ? Any E-Mail address to which I can send the file so that you may posy it in the blog.

    Reply

  73. Posted by Sharan Asundi on September 16, 2016 at 3:01 pm

    Wonderful archive!! Thanks for taking the time to provide such an elaborate collection. Do you happen to have the lyrics or the recitation of the following manglaarti..

    Rakshi saika runya sindhuve rakshi saikula bandhuve
    Rakshi semmanu kayyi biDadali paksha paatava maaDadhe.

    Its sung a lot in Uttara Karanataka.

    Again, sincere gratitude.

    Reply

  74. Posted by Arvind Subramanian on September 10, 2016 at 10:16 am

    Hello, can you send Purandaradasa songs in Tamil script.

    Thanks,
    Arvind Subramanian
    arvindsubbu@gmail.com

    Reply

  75. Posted by Lakshman on September 2, 2016 at 6:46 am

    Meera: I was not asking you personally to transliterate the songs. There are many other rasikas who are part of this forum that can help out. Thanks.

    Reply

  76. Posted by Lakshman on September 1, 2016 at 4:23 pm

    I am disappointed to see that no one has come forward to help me with the transliteration of the songs at the http://bhaavisameera.com/songs-kruthigalu site. If someone who know Kannada can spend 5 minutes each day on a single song, all of the 45 songs can be done in 45 days. Thanks.

    Reply

    • Posted by meeraghu on September 1, 2016 at 5:00 pm

      Lakshman, sorry to disappoint you, but my schedule has been very hectic the past few weeks, and will continue as such for the next month. Hopefully, in October might have some time to look at the songs and translate.

      Reply

  77. Posted by n.s. madhu on August 27, 2016 at 12:32 am

    sir i want audio of mahalakshmi ashtakam sung by vidyabhushan kindly help me in this regard

    Reply

  78. Posted by Lakshman on August 20, 2016 at 7:56 am

    yativara nimmanu. rAgA: shuddhsArang. Adi tALA. Vidyaprasanna Tirtha.

    P: yativara nimmanu stutipa janaru divya gatiyanu ponduvaru rAghavEndra
    A: kSitiyoLage dashapramatigaLa sukhakara matada parama sangatigaLa haraDida
    C1: mangaLakaravAda tungAnadiya tarangagaLali mindu
    kangaLi nODi nimmanu guNagaLa pADi nissangarAda sAdhu sanghava poreyuva
    2: paripariyindali nimma namipa sEvakarige suradhEnuvinante santata
    haruSadindali nimma bhajipa sujanarige surataruvante prasannarAguvantha

    Reply

  79. Posted by Janavi M on August 18, 2016 at 7:09 am

    Meeraji,
    Namaskara. very useful site and i have noted so many lyrics from this. I need the lyrics of song “Yathivara nimmanu stuthipa janaru dhivya gathiyanu hondhuvaru Raghavendra” i heard this song sung by Ms.Sunanda in radio some 20 years back. if i can get this full lyrics it will be very greatful. Thanks.

    Reply

  80. Posted by Shiva on August 12, 2016 at 12:21 pm

    madam/ Sir. I need a old kannada aarati song lyrics karpurarati belaguve karunya mrugakara devage & gnanpoornam jagaum jyothi nirmalavada manave karporaarati …

    Reply

  81. Posted by Lakshman on August 7, 2016 at 7:54 pm

    Corrections welcome:
    bhaLibhaLire nArasimha. rAgA: candrakauns. t/Adi tALA. Vijayadasa.

    P: bhaLibhaLire nArasimhA mahA simha mala malA mala tavara vairi urimAri
    A: naga nagA nagaLellADE caturdasha jaga jagA jagavellA samsthititapAgE
    hage hagE hagE balavada shageDasi rashagidi hugu hugu huguLutta banda nArasimha
    C1: bigi bigi bigi bigidu huddu ghaNTane hAke hoge hogE hogesuttE sarvarande
    nege negE negE negadu puppaLisi asuranna madhu madhu madhu bEDikoNDa nArasimha
    2: hugu hugU hugurinda krUranda heroDala bagE bagE bagE bagedu raguttavannu
    hugi hugI hugi hugidu celli koraLige karuLana tagE tagE tagetegaduhiTTa nArasimha
    3: yuga yuga yugadoLage praNatArthi haranandu jhaga jhaga jhaga jhaga makuTasugE
    nagu nagu nagu naguta suraru gaganadi neredu migi migi migilini nArasimha
    4: ondondondondondu munigaLi golidu andanadandadi gAyanake olidu
    andandandapara kAva tOlangiri mandirana vijayaviThala nArasimha

    Reply

  82. Posted by P.S.Thammanna on August 7, 2016 at 12:06 pm

    ಭಳಿರೆ ಭಳಿರೆ ನಾರಸಿಂಹ

    ಶ್ರೀರಮಣೀಕರ ಕಮಲ ಪೂಜಿತಾ
    ಚಾರು ಚರಣ ಸರೋಜ
    ಬ್ರಹ್ಮ ಸವೀರವಾಣಿ ಫಣೀಂದ್ರವೀಂದ್ರ
    ಭವೇಂದ್ರ ಮುಖವಿನುತಾ
    ನೀರಜ ಭವಾಂಡೋದಯ ಸ್ಥಿತಿ ಕಾರಣನೇ
    ಕೈವಲ್ಯ ದಾಯಕ, ನಾರಸಿಂಹನೇ
    ನಮಿಪೆ ಕರುಣಿಪುದೆಮಗೆ ಮಂಗಳವ,

    ಭಳಿರೆ ಭಳಿರೆ ನಾರಸಿಂಹ ಮಹಸಿಂಹ
    ಮಲ ಮಲ ಮಲತವರ ವೈರಿ ಉರಿಮಾರಿ

    ಮಗನ ಗಾನಗಳಲ್ಲಾಡಿದ ಚತುರ್ದಶ
    ಜಗ ಜಗ ಜಗವೆಲ್ಲಾ ಕಂಪಿಸೆ ಕಂಬಾಹೇ
    ಹಗೆ ಹಗೆ ಹಗೆಬಲವ ದೆಶೆಗೆಡಿಸಿ ರೋಷಗಿಡಿ
    ಉಗು ಉಗು ಉಗುಳುತ್ತ ಬಂದ ನಾರಸಿಂಹ

    ಬಿಗಿ ಬಿಗಿ ಬಿಗಿದು ಹುಬ್ಬುಗಂಟನೆ ಹಾಕಿ
    ಹೊಗೆ ಹೊಗೆ ಹೊಗೆಸುತ್ತಿ ಸರ್ವರಂಜೆ
    ನೆಗೆ ನೆಗೆ ನೆಗೆದು ಕುಪ್ಪಳಿಸಿ ಅಸುರನ್ನ
    ಮಗು ಮಗು ಮಗು ಬೇಡಿಕೊಂಡ ನಾರಸಿಂಹ

    ಉಗು ಉಗು ಉಗುರಿಂದ ಕ್ರೂರನ್ನ ಹೇರೊಡಲ
    ಬಗ ಬಗ ಬಗ ಬಗೆದು ರಗುತವನ್ನು
    ಉಗಿ ಉಗಿ ಉಗಿ ಉಗಿದು ಚೆಲ್ಲಿ ಕೊರಳಿಗೆ ಕರುಳ
    ತೆಗೆ ತೆಗೆ ತೆಗೆ ತೆಗೆದಿಟ್ಟ ನಾರಸಿಂಹ

    ಯುಗ ಯುಗ ಯುಗ ಯುಗದೊಳಗೆ ಪ್ರಣತಾರ್ತಿಹರನೆಂದು
    ಝಗ ಝಗ ಝಗ ಝಗಿಪ ಮಕುಟ ತೂಗೇ
    ನಗು ನಗು ನಗು ನಗುತ ಸುರರು ಗಗನದಿ ನೆರೆದು
    ಭಳಿರೆ ಭಳಿರೆ ನಾರಸಿಂಹ

    bhaLire bhaLire nArasiMha

    shrIramaNIkara kamala pUjitA
    cAru caraNa sarOja
    brahma savIravANi PaNIMdravIMdra
    bhavEMdra muKavinutA
    nIraja bhavAMDOdaya sthiti kAraNanE
    kaivalya dAyaka, nArasiMhanE
    namipe karuNipudemage maMgaLava,

    bhaLire bhaLire nArasiMha mahasiMha
    mala mala malatavara vairi urimAri

    magana gAnagaLallADida caturdasha
    jaga jaga jagavellA kaMpise kaMbAhE
    hage hage hagebalava deshegeDisi rOShagiDi
    ugu ugu uguLutta baMda nArasiMha

    bigi bigi bigidu hubbugaMTane hAki
    hoge hoge hogesutti sarvaraMje
    nege nege negedu kuppaLisi asuranna
    magu magu magu bEDikoMDa nArasiMha

    ugu ugu uguriMda krUranna hEroDala
    baga baga baga bagedu ragutavannu
    ugi ugi ugi ugidu celli koraLige karuLa
    tege tege tege tegediTTa nArasiMha

    yuga yuga yuga yugadoLage praNatArtiharaneMdu
    Jaga Jaga Jaga Jagipa makuTa tUgE
    nagu nagu nagu naguta suraru gaganadi neredu
    bhaLire bhaLire nArasiMha

    பளிரெ பளிரெ னாரஸிம்ஹ

    ஶ்ரீரமணீகர கமல பூஜிதா
    சாரு சரண ஸரோஜ
    ப்ரஹ்ம ஸவீரவாணி பணீம்த்ரவீம்த்ர
    பவேம்த்ர முகவினுதா
    னீரஜ பவாம்டோதய ஸ்திதி காரணனே
    கைவல்ய தாயக, னாரஸிம்ஹனே
    னமிபெ கருணிபுதெமகெ மம்களவ,

    பளிரெ பளிரெ னாரஸிம்ஹ மஹஸிம்ஹ
    மல மல மலதவர வைரி உரிமாரி

    மகன கானகளல்லாடித சதுர்தஶ
    ஜக ஜக ஜகவெல்லா கம்பிஸெ கம்பாஹே
    ஹகெ ஹகெ ஹகெபலவ தெஶெகெடிஸி ரோஷகிடி
    உகு உகு உகுளுத்த பம்த னாரஸிம்ஹ

    பிகி பிகி பிகிது ஹுப்புகம்டனெ ஹாகி
    ஹொகெ ஹொகெ ஹொகெஸுத்தி ஸர்வரம்ஜெ
    னெகெ னெகெ னெகெது குப்பளிஸி அஸுரன்ன
    மகு மகு மகு பேடிகொம்ட னாரஸிம்ஹ

    உகு உகு உகுரிம்த க்ரூரன்ன ஹேரொடல
    பக பக பக பகெது ரகுதவன்னு
    உகி உகி உகி உகிது செல்லி கொரளிகெ கருள
    தெகெ தெகெ தெகெ தெகெதிட்ட னாரஸிம்ஹ

    யுக யுக யுக யுகதொளகெ ப்ரணதார்திஹரனெம்து
    ஜக ஜக ஜக ஜகிப மகுட தூகே
    னகு னகு னகு னகுத ஸுரரு ககனதி னெரெது
    பளிரெ பளிரெ னாரஸிம்ஹ

    भळिरे भळिरे नारसिंह

    श्रीरमणीकर कमल पूजिता
    चारु चरण सरॊज
    ब्रह्म सवीरवाणि फणींद्रवींद्र
    भवॆंद्र मुखविनुता
    नीरज भवांडॊदय स्थिति कारणनॆ
    कैवल्य दायक, नारसिंहनॆ
    नमिपे करुणिपुदेमगे मंगळव,

    भळिरे भळिरे नारसिंह महसिंह
    मल मल मलतवर वैरि उरिमारि

    मगन गानगळल्लाडिद चतुर्दश
    जग जग जगवेल्ला कंपिसे कंबाहॆ
    हगे हगे हगेबलव देशेगेडिसि रॊषगिडि
    उगु उगु उगुळुत्त बंद नारसिंह

    बिगि बिगि बिगिदु हुब्बुगंटने हाकि
    होगे होगे होगेसुत्ति सर्वरंजे
    नेगे नेगे नेगेदु कुप्पळिसि असुरन्न
    मगु मगु मगु बॆडिकोंड नारसिंह

    उगु उगु उगुरिंद क्रूरन्न हॆरोडल
    बग बग बग बगेदु रगुतवन्नु
    उगि उगि उगि उगिदु चेल्लि कोरळिगे करुळ
    तेगे तेगे तेगे तेगेदिट्ट नारसिंह

    युग युग युग युगदोळगे प्रणतार्तिहरनेंदु
    झग झग झग झगिप मकुट तूगॆ
    नगु नगु नगु नगुत सुररु गगनदि नेरेदु
    भळिरे भळिरे नारसिंह
    Perhaps this helps you, Mr Sudar raju. The text may require some corrections here and there.

    Reply

  83. Posted by soundararaja on August 7, 2016 at 4:59 am

    i want phalire phalire narasimha lyrics in english please sent

    Reply

  84. Posted by Lakshman on August 3, 2016 at 10:25 am

    I check this website every day hoping to see the transliterated songs from the above website. Thanks.

    Reply

  85. Posted by Lakshman on July 20, 2016 at 9:27 am

    Meera Subbarao: My apologies. Please delete my incorrect posting. Here is the correct link for the Vadirajasvami’s songs. Would appreciate transliteration of these songs. I tried Baraha but the output was gibberish. Thanks.
    http://bhaavisameera.com/songs-kruthigalu/

    Reply

  86. Posted by P.S.Thammanna on July 19, 2016 at 9:29 am

    We are all surprised as well.

    Reply

  87. Posted by P.S.Thammanna on July 19, 2016 at 9:24 am

    We are all surprised as well. How an un welcome article can appear!

    Reply

  88. Posted by Lakshman on July 18, 2016 at 3:29 pm

    I don’t know how some article on Buddhism got posted along with my comment.

    Reply

  89. Posted by Lakshman on July 17, 2016 at 11:08 am

    Would Meera Subbarao or anyone else be kind enough to transliterate the songs by Vadirajasvami from this website and post them here in English script? Thanks.

    Reply

  90. Posted by Nithish Kamath on July 13, 2016 at 11:11 am

    Thanks a lot Lakshman sir

    Reply

  91. Posted by Harish on July 5, 2016 at 7:43 am

    can u please get me the song link and lyrics in kannada for “Jeste aadalu tapade sahasra bindu; kanishte aagi haridalu ashaka bindu…………amrutava kareya kumara dare yaayitu……….subramanya swami ninna “

    Reply

  92. Posted by Harish on July 5, 2016 at 7:03 am

    Can u please get me the lyrics of Swami mukhya prana in Kannada.

    Reply

  93. i want lyrics song gopi kel ninna maga jara eva chora sukumara

    Reply

  94. Posted by Lakshman on June 24, 2016 at 4:19 pm

    In the last line of caraNA 4 the word should read gambhIrya. Other corrections welcome. Thanks.

    Reply

    • Posted by Lakshman on June 27, 2016 at 11:51 am

      anudinA ninna nenedu. rAgA: hindOLa. Adi tALA.

      P: anudinA ninna nenedu manavu ninnali ninnali
      A: duhkhasukha lekkisade mukhya phala munidarise mikkuta sokki mOhakke sikkade mana
      C1: ninna guNa varNisuta ninnavara mannisuta ninna pAvanna lAvaNya dhyAnise mana
      2: santOSa nirantaravu santajana sahavAsavu shAntatvavAnta mahAnta dhairyadi mana
      3: bhakti suvirakti dhyAna muktige mukhya kAraNa cittadoLittalla hottu hottige mana
      4: priya shrI lakSuminArAyaNa pArAyaNanu dhairyadantarya gambhIrya bhAvadi mana

      Reply

  95. Posted by Lakshman on June 24, 2016 at 4:15 pm

    anudina ninna nEnEdu. rAgA: hindOLa. Adi tALA.

    P: anudina ninna nEnEdE manavE ninnallI ninnallI
    A: duhkhasukha lekkitade mukhya phala nenidarise mikkuta tokki mOhakke sikkade mana
    C1: ninna guNa varNituta ninna vara mannisuta ninna pAvanna lAvaNya dhyAniseE manavu
    2: santOsha nirantaravu santajana sahavAsavu shAntatvavAnta mahAnta dhairyadi mana
    3: bhaktisuvi rakti dhyAna muktige mukhya kAraNa cittadoLittalla hoTTu hoTTige mana
    4: priya shrI lakSuminArAyaNa pArAyaNanu dhairyadantarya gambhIya bhAvadi mana

    Reply

  96. Posted by H.S. Padmaja on June 24, 2016 at 2:37 am

    This facility is very nice to spread spritual Knowldge for the universe

    Reply

  97. Posted by Nithish Kamath on June 22, 2016 at 1:53 am

    Can anyone provide lyrics of “Anu dina ninna nEnEdu manavU ninnalI nillalI”

    Reply

  98. Posted by ashwini on June 6, 2016 at 3:36 am

    Hi
    Can u post lyrics of prahalad charitra. Please
    That would be so helpful

    Reply

  99. Posted by Lakshman on May 23, 2016 at 12:26 pm

    Request to all who post in languages other than English: Please provide an equivalent transliteration in English so that all of us can benefit from what is being posted. Thanks.

    Reply

  100. Posted by GAYATHRI on May 14, 2016 at 7:55 am

    ನನಗೆ ಈ ಹಾಡಿನ ಪಲ್ಲವಿ ತಿಳಿಯದು
    ಹಾಡಿನ ಚರಣದಲ್ಲಿ ನೆತ್ತಿಗೆ ನಾರಾಯಣನ ರಕ್ಷೆ, ಭುಜಗಳಿಗೆ ಭೀಮನ ರಕ್ಷೆ, ಕಣ್ಣುಗಳಿಗಿ ಮನ್ಮಥನ ರಕ್ಷೆ ಈ ರೀತಿ ಮಕ್ಕಳಿಗೆ ರಕ್ಷೆ ಇಡುವ ಹಾಡು ಇದೆಯಂತೆ ದಯವಿಟ್ಟು ನಿಮಗೆ ಇದರ ಪೂತಿ೯ ಲಿಪಿ ಸಿಕ್ಕರೆ ಕಳುಹಿಸಿ ಕೊಡಿ
    ವಂದನೆಗಳು.
    ಗಾಯತ್ರಿ

    Reply

  101. Does anyone have the lyrics to jiv sane fareche gumand ma?

    Please email me

    Reply

  102. Posted by ROOPA on February 18, 2016 at 5:06 am

    Hi Meera,

    Please request u to provide me the lyrics of
    1)JAGADEESHWARI BAARAMMA CHITTHA MANDIRAKKE BAARAMMA
    2)PAVADHADAYALI SHARADE GAANA

    Reply

  103. Posted by shubha on February 12, 2016 at 2:03 am

    could u kindly post the song sung during magha masa on gowri ( it goes like this : kashigadyatika bahu karnooinalli obba badha brahmana eralu. putrarelu mandi……….

    Reply

  104. Posted by Lakshman on February 8, 2016 at 3:48 pm

    Meera Subbarao: I submitted a message for you about converting pdf files into English text. Wonder if you got it. Thanks.

    Reply

  105. Posted by Lakshman on February 6, 2016 at 11:18 am

    Meera: I see a lot of songs in kannaDa script on the web but I am unable to convert them into Roman script because they are in pdf format or jpeg format. Do you know of any way I can access these songs? I tried Baraha but it does not work out. Thanks.

    Reply

  106. Posted by Lakshman on January 16, 2016 at 4:10 pm

    The audio is available at kannadaaudio.com site.

    Reply

  107. Posted by Lakshman on January 16, 2016 at 4:07 pm

    The audio clip is available at kannadaaudio.com site.

    Reply

  108. Posted by Akhila on January 16, 2016 at 9:51 am

    Meeraji, I would be grateful if you could send me the lyrics of Chakra rajasthithe chakra vaalanvithe vakra vaagvandite vikramanandite

    Reply

  109. Posted by AR on January 7, 2016 at 10:33 am

    Please help me get the lyrics for ‘shanka chakra gada padma’ sung by Sri Vidyabhusana at the end of dwadasha stotra cd. In Kannada, please. Thank you.

    AR

    Reply

  110. Posted by Lakshman on December 18, 2015 at 9:45 am

    The song is available here, without accompaniments, so you can easily figure out the words.

    Reply

  111. Posted by Gowri Desai on December 18, 2015 at 1:08 am

    hello, I want lyrics and song as well of “Bhakta Vatsala Pandhari Raaya, Vittala Pidi enna kaiya” sung by Puttur Narasimha Nayak. That Audio casste got released by name of Bhaktavatsala. Plz give me the details of this song.

    Reply

  112. Posted by Lakshman on December 16, 2015 at 5:11 pm

    Here is the ITRANS English version:

    narasimhanembo dEvanu. rAgA: suraTi. Ad tALA. Purandaradasa.

    P: narasimhanembo dEvanu nambidantha nararigella varava koDuvanu
    C1: Adiyalli lakSmI sahitadi malagiralu bandarAga sanatkumAraru
    Aga dvArapAlakaru taDeyalAga kOpadinda mUru janmadalli nIvu asurarAgi puTTirendaru
    2: ditiya garbhadalli janisidA hiraNyAkSa hiraNyakashipuremba bhrAtruru
    prthviyannu muLugisida kAraNAdi shrIhariyu trtIya rUpadinda khaLana kondu dhareyanuLuhidAnu
    3: anujanAda hiraNyAkSana maraNavannu kELi Aga naDeda tapasige
    hariya mEle sittininda ugra tapassannu mADi brahmaninda varagaLannu paDedukondu bandanAga
    4: indra lOka sUre mADidA mUru lOkake asura tanna bhayava tOridA
    garbhiNi kayAduvannu brahmaputra bandu Aga daityarAja hiraNyakashipuvige oppisidA
    5: nava mAsagaLu tumbalu kayAdu Aga putraratnavannu paDedaLu
    nAmakaraNavannu mADi viprarannu karesi bEga daitya tanna sutage prahlAdanendu karesidAnu
    6: Om namaha shivAya enutali asura tanna sutana baredu tOru embga narahariya
    nAmavannu nagunagutale bareyutiralu eDadoDeya mEle shishuva dharege baDedu nUkidanu
    7: sutta janara karesi bEgadi asura tanna sutana kollisa bEkandAga aTTa aDaviyoL
    viSavaniTTu bhOjanangaL mADi hariya smaraNe mADutale kunji tiLida jaTTi hAnge
    8: ambudiyoLu magana malagisi mEle doDDa beTTavannu iTTu banniro hariya krpage
    vashanAda taraLanendu varuNa dEva maraNa illada hAge mADi maneya taUUt kaLuhidanu
    9: beTTadinda kaTTI uruLisi asura tanna paTTadAne kAlisi meTTisi haralu maneya
    mADi suTTu huliya bOninalli iTTu yatnavillade sutana kollalikke shaktanallade pOdanante
    10: ninna dEva idda eDeyanu tOru enuta pitanu tanna sutanu kOralu enna dEva
    illadanda eDegaLuNTe lOkadalli kambadallu iruvanendu kaiya mugidu tOrdanAga
    11: vara khambavanu odeyalu narahariyu ugra kOpavannu tALida kaTakaDemba
    dhvaniya mADi nagagaLinda piDidu otti karuLa bagidu mAle hAki kanda bhaktanappi koNDa
    12: antarikSadalli amararu nODi Aga puSpa vrSTiyanne kareyalu ajana paDeda
    dEvi bandu toDeya mEle kuLidu koNDu amara patiyarella nODi anja beDenda bhaya koTTa
    13: lakSmI narasimha na cariteya udayakAla paDisuvanda nararigella putra santAnangaLittu
    mattu bEDida hAge koTTu bhaktavatsala mukti koDuva purandara viTTalarAya

    Reply

  113. Posted by P.S.Thammanna on December 16, 2015 at 5:52 am

    Please feel free to comment on correctness and usefulness of this transliteration to Tamil.
    ராக: ஸுரடி- ஆதிதாள
    னரஸிம்ஹனெம்பொ தேவரு | னம்பிதம்த | னரரிகெல்ல வரவ கொடுவனு ||ப|| ஓம் னமஃ ஶிவாய எனுதலி | அஸுர தன்ன | ஸுதன பரெது தோரு எம்தாக னரஹரி னாமவன்னு னகுதலெ பரெயுதிரலு பூபதொடெய மேலெ ஶிஶுவ தரெகெ படெது னூகிதனு ||௧|| ஸுத்து ஜனர கரெஸிபேகதிம் அரஸு தன்ன | ஸுதன கொல்லிஸபேகெம்தாக | அட்ட அடவியொள் விஷவ னிட்ட போஜனம்கள மாடெ | ஹரிய ஸ்மரணெ மாடுதலே கும்ஜி திளித ஜட்டி ஹாம்கெ ||௨|| அம்புதியோள் மகன மலகிஸி | மேலெ தொட்ட | பெட்டவன்னு இட்டு பன்னிரொ | ஹரிய க்றுபெகெ வஶனாத தரளனெம்து வருணதேவ | மரண இல்லத்‍ஹாகெ மாடி மனெகெ களுஹிதனு ||௩|| பெட்டதிம்த கட்டி உருளிஸி தன்ன | பட்டதானெ காலலி மெட்டிஸி | ஹரலு மனெய மாடி ஸுட்டு ஹுலிய போனினல்லி இட்டு | யத்னவில்லதெ ஸுதன கொல்லலிக்கெ ஶக்தனல்லதெ போதனம்தெ ||௪|| னின்ன தேவ இத்த எடெயனு தோரு | எனுத பிதனு தன்ன ஸுதன கோரலு | என்ன தேவ இல்லதம்த எடெகளும்டெ லோகதல்லி | கம்பதல்லி இருவனெம்து கைமுகிது தோர்வனாக ||௫|| வர கம்பவன்னு ஒதெயலு னரஹரியு | உக்ரரூபவன்னு தாளி | கடகடெம்ப த்வனிய மாடி னககளிம்த பிடிது ஒத்தி | கருள பகெது | மாலெ ஹாகி கம்த பக்தனப்பிகொம்ட ||௬|| அம்தரிக்ஷதல்லி அமரரு | னோடி ஆக | புஷ்பவ்றுஷ்டியன்னெ கரெயலு | அஜன படெத தேவி பம்து தொடெயமேலெ குளிதுகொம்டு | அமரபதியரெல்ல னோடி அம்ஜபேடெம்பபய கொட்டு ||௭|| லக்ஷ்மீனாரஸிம்ஹன சரித்ரெயு | உதயகால | படிஸுவம்த னரரிகெல்ல | புத்ரஸம்தானகளித்து மத்து பேடித்‍ஹாகெ கொட்டு | பக்தவத்ஸல முக்தி கொடுவ புரம்தர விடலராய ||௮||

    னரஸிம்ஹனெம்போ தேவரு னம்பிதம்த னரரிகெல்ல வரவ கொடுவனு ||
    ஆதியல்லி லக்ஷ்மி ஸஹித மலகிரலு பம்தராக ஸனத்குமாரரு
    ஆக த்வாரபாலகரு தடெயலாக கோபதிம்த
    மூருஜன்மதல்லி னீவு அஸுரராகி புட்டிரெம்து ||௧||
    திதிய கர்பதல்லி ஜனிஸித ஹிரண்யாக்ஷ ஹிரண்யகஶிபுரெம்ப ப்ரார்தரு
    ப்றுதிவியன்னு முளுகிஸித காரண ஶ்ரீ ஹரியு த்றுதிய
    ரூபதிம்த களனகொம்து தரெயனுளுஹிதனு ||௨||
    அனுஜனாத ஹிரண்யாக்ஷன மரணவன்னு கேளி ஆக னடெத தபஸிகெ
    ஹரிய மேலெ ஸிட்டினிம்த உக்ர தபஸ்ஸன்னு மாடி
    ப்ரஹ்மனிம்த வரகளன்னு படெதுகொம்டு பம்தனாக ||௩||
    இம்த்ரலோக ஸூரெமாடித மூரு லோககெ ஆஸுரதன்ன பயவ தோரித
    கர்பிணி கயாதுவன்னு ப்ரஹ்மபுத்ர பம்து ஆக
    தைத்யராஜ ஹிரண்ய கஶிபுவிகெ ஒப்பிஸிதனு ||௪||
    னவமாஸகளு தும்பலு கயாது ஆக புத்ரரத்னவன்னு படெதளு
    னாமகரணவன்னு மாடி விப்ரரன்னு கரெஸி பேக
    தைத்ய தன்ன ஸுதனிகெ ப்ரஹ்லாதனெம்து கரெஸிதனு ||௫||
    பாலசம்த்ரனம்தெ ஹொளெயுத இருதிரலு ஐதுவர்ஷ தும்பிதாகலெ
    குருகளன்னு கரெஸி பேக ஸகல வித்யெகளன்னு கலிஸிரெம்து
    குருகளிகெ மகனன்னு ஒப்பிஸித தைத்ய தானு ||௬||
    ஓம் னமஶ்ஶிவாய எனுத அஸுர தன்ன ஸுதன பரெது தோரு என்னலு
    னரஹரிய னாமவன்னு னகுனகுதலெ பரெயுதிரலு
    எடத தொடெய மேலிம்த ஶிஶுவ படிது தரெகெ னூகிதனு ||௭||
    ஸுத்த ஜனர கரெஸி பேகதி அஸுர தன்ன ஸுதன கொலிஸ பேகு எம்தாக
    அத்த அடவியொளு விஷவனிட்டு போஜனகளமாடி
    ஹரிய ஸ்மரணெ மாத்ரதிம்த பும்ஜி திளித ஜட்டிஹாம்கெ ||௮||
    அம்புதியொளு மகன மலகிஸி மேலெ தொட்ட பெட்டவன்னிட்டு பன்னிரோ
    ஹரிய க்றுபெகெ வஶனாத தரளனெம்து வருணதேவ
    மரண இல்லத்‍ஹாகெ மாடி மனெகெ கொட்டு களுஹிதனு ||௯||

    பெட்டதிம்த கட்டி உருளிஸி அஸுர பட்டதானெ காலலி மெட்டிஸி
    உரியுவ ஒலெய மாடி ஸுட்டு ஹுலியபோனினல்லி இட்டு
    யத்னவில்லதெ ஸுதன கொல்லலு ஶக்தனல்லதெ போதனம்தெ ||௧0||
    னின்ன தேவ இத்தயெடெயனு தோருயெனுத பிதனு தன்ன ஸுதன கோரலு
    யென்ன தேவ இல்லதம்த யெடெகளும்டெ லோகதல்லி
    கம்பதல்லு இருவனெம்து கைய முகிது தோர்தனாக ||௧௧||
    னரஹரி னரஹரி பா பா
    னரஹரி னரஹரி பா பா
    வரகம்பவன்னு வொதெயலு னரஹரியு உக்ர கொபவன்னு தாளித

    ஸத்யம் விதாதும் னிஜப்றுத்யபாஶிதம் வ்யாப்திம் ச பூதேஶ்வகிலேஶு சாத்மனஃ|
    அத்யஸ்யதாத்யத்புதரூபமுத்வஹன் ஸ்தம்பெ ஸபாயாம் ன ம்றுகம் ன மானுஷம்||

    கடகடெம்ப த்வனிய மாடி னககலிம்த பிடிது ஒத்தி
    கருள பகெது மாலெ ஹாகி கம்த பக்தனப்பிகொம்ட ||௧௨||
    அம்தரிக்ஷதல்லி அமரரு னோடி ஆக புஷ்பவ்றுஷ்டியன்னெ கரெதரு
    அஜன படெத தேவி‍ பம்து தொடெய மேலெ குளிதிரலு
    அமரபதியரெல்ல னோடி அம்ஜ பேடெம்பபய கொட்ட ||௧௩||
    லக்ஷ்மீ னரஸிம்ஹ சரிதெய உதய கால படிஸுவம்த னரரிகெல்ல
    புத்ரஸம்தானம்களித்து மத்தெ பேடித்‍ஹாம்கெ கொட்டு
    பக்தவத்ஸல முகுதி கொடுவ புரம்தர விடல ராய ||௧௩||

    Reply

  114. Posted by P.S.Thammanna on December 16, 2015 at 1:00 am

    Please be specific. There are many songs on Rayaru.

    Reply

  115. Posted by Devarajan vedagarbha on December 14, 2015 at 9:57 pm

    I want Rayaru songs

    Reply

  116. Posted by P.S.Thammanna on December 11, 2015 at 10:52 pm

    I have posted twice it seems! Never mind duplication.
    P.S.T

    Reply

  117. Posted by P.S.Thammanna on December 11, 2015 at 11:35 am

    There are two versions; May please see.
    ರಾಗ: ಸುರಟಿ- ಆದಿತಾಳ
    ನರಸಿಂಹನೆಂಬೊ ದೇವರು | ನಂಬಿದಂಥ | ನರರಿಗೆಲ್ಲ ವರವ ಕೊಡುವನು ||ಪ|| ಓಂ ನಮಃ ಶಿವಾಯ ಎನುತಲಿ | ಅಸುರ ತನ್ನ | ಸುತನ ಬರೆದು ತೋರು ಎಂದಾಗ ನರಹರಿ ನಾಮವನ್ನು ನಗುತಲೆ ಬರೆಯುತಿರಲು ಭೂಪತೊಡೆಯ ಮೇಲೆ ಶಿಶುವ ಧರೆಗೆ ಬಡೆದು ನೂಕಿದನು ||೧|| ಸುತ್ತು ಜನರ ಕರೆಸಿಬೇಗದಿಂ ಅರಸು ತನ್ನ | ಸುತನ ಕೊಲ್ಲಿಸಬೇಕೆಂದಾಗ | ಅಟ್ಟ ಅಡವಿಯೊಳ್ ವಿಷವ ನಿಟ್ಟ ಭೋಜನಂಗಳ ಮಾಡೆ | ಹರಿಯ ಸ್ಮರಣೆ ಮಾಡುತಲೇ ಕುಂಜಿ ತಿಳಿದ ಜಟ್ಟಿ ಹಾಂಗೆ ||೨|| ಅಂಭುಧಿಯೋಳ್ ಮಗನ ಮಲಗಿಸಿ | ಮೇಲೆ ದೊಡ್ಡ | ಬೆಟ್ಟವನ್ನು ಇಟ್ಟು ಬನ್ನಿರೊ | ಹರಿಯ ಕೃಪೆಗೆ ವಶನಾದ ತರಳನೆಂದು ವರುಣದೇವ | ಮರಣ ಇಲ್ಲದ್‍ಹಾಗೆ ಮಾಡಿ ಮನೆಗೆ ಕಳುಹಿದನು ||೩|| ಬೆಟ್ಟದಿಂದ ಕಟ್ಟಿ ಉರುಳಿಸಿ ತನ್ನ | ಪಟ್ಟದಾನೆ ಕಾಲಲಿ ಮೆಟ್ಟಿಸಿ | ಹರಲು ಮನೆಯ ಮಾಡಿ ಸುಟ್ಟು ಹುಲಿಯ ಬೋನಿನಲ್ಲಿ ಇಟ್ಟು | ಯತ್ನವಿಲ್ಲದೆ ಸುತನ ಕೊಲ್ಲಲಿಕ್ಕೆ ಶಕ್ತನಲ್ಲದೆ ಪೋದನಂತೆ ||೪|| ನಿನ್ನ ದೇವ ಇದ್ದ ಎಡೆಯನು ತೋರು | ಎನುತ ಪಿತನು ತನ್ನ ಸುತನ ಕೋರಲು | ಎನ್ನ ದೇವ ಇಲ್ಲದಂಥ ಎಡೆಗಳುಂಟೆ ಲೋಕದಲ್ಲಿ | ಕಂಭದಲ್ಲಿ ಇರುವನೆಂದು ಕೈಮುಗಿದು ತೋರ್ವನಾಗ ||೫|| ವರ ಕಂಭವನ್ನು ಒದೆಯಲು ನರಹರಿಯು | ಉಗ್ರರೂಪವನ್ನು ತಾಳಿ | ಕಟಕಟೆಂಬ ಧ್ವನಿಯ ಮಾಡಿ ನಖಗಳಿಂದ ಪಿಡಿದು ಒತ್ತಿ | ಕರುಳ ಬಗೆದು | ಮಾಲೆ ಹಾಕಿ ಕಂದ ಭಕ್ತನಪ್ಪಿಕೊಂಡ ||೬|| ಅಂತರಿಕ್ಷದಲ್ಲಿ ಅಮರರು | ನೋಡಿ ಆಗ | ಪುಷ್ಪವೃಷ್ಟಿಯನ್ನೆ ಕರೆಯಲು | ಅಜನ ಪಡೆದ ದೇವಿ ಬಂದು ತೊಡೆಯಮೇಲೆ ಕುಳಿತುಕೊಂಡು | ಅಮರಪತಿಯರೆಲ್ಲ ನೋಡಿ ಅಂಜಬೇಡೆಂಬಭಯ ಕೊಟ್ಟು ||೭|| ಲಕ್ಷ್ಮೀನಾರಸಿಂಹನ ಚರಿತ್ರೆಯು | ಉದಯಕಾಲ | ಪಠಿಸುವಂಥ ನರರಿಗೆಲ್ಲ | ಪುತ್ರಸಂತಾನಗಳಿತ್ತು ಮತ್ತು ಬೇಡಿದ್‍ಹಾಗೆ ಕೊಟ್ಟು | ಭಕ್ತವತ್ಸಲ ಮುಕ್ತಿ ಕೊಡುವ ಪುರಂದರ ವಿಠಲರಾಯ ||೮||

    ನರಸಿಂಹನೆಂಬೋ ದೇವರು ನಂಬಿದಂಥ ನರರಿಗೆಲ್ಲ ವರವ ಕೊಡುವನು ||
    ಆದಿಯಲ್ಲಿ ಲಕ್ಷ್ಮಿ ಸಹಿತ ಮಲಗಿರಲು ಬಂದರಾಗ ಸನತ್ಕುಮಾರರು
    ಆಗ ದ್ವಾರಪಾಲಕರು ತಡೆಯಲಾಗ ಕೋಪದಿಂದ
    ಮೂರುಜನ್ಮದಲ್ಲಿ ನೀವು ಅಸುರರಾಗಿ ಪುಟ್ಟಿರೆಂದು ||೧||
    ದಿತಿಯ ಗರ್ಭದಲ್ಲಿ ಜನಿಸಿದ ಹಿರಣ್ಯಾಕ್ಷ ಹಿರಣ್ಯಕಶಿಪುರೆಂಬ ಭ್ರಾರ್ತರು
    ಪೃಥಿವಿಯನ್ನು ಮುಳುಗಿಸಿದ ಕಾರಣ ಶ್ರೀ ಹರಿಯು ತೃತಿಯ
    ರೂಪದಿಂದ ಖಳನಕೊಂದು ಧರೆಯನುಳುಹಿದನು ||೨||
    ಅನುಜನಾದ ಹಿರಣ್ಯಾಕ್ಷನ ಮರಣವನ್ನು ಕೇಳಿ ಆಗ ನಡೆದ ತಪಸಿಗೆ
    ಹರಿಯ ಮೇಲೆ ಸಿಟ್ಟಿನಿಂದ ಉಗ್ರ ತಪಸ್ಸನ್ನು ಮಾಡಿ
    ಬ್ರಹ್ಮನಿಂದ ವರಗಳನ್ನು ಪಡೆದುಕೊಂಡು ಬಂದನಾಗ ||೩||
    ಇಂದ್ರಲೋಕ ಸೂರೆಮಾಡಿದ ಮೂರು ಲೋಕಕೆ ಆಸುರತನ್ನ ಭಯವ ತೋರಿದ
    ಗರ್ಭಿಣಿ ಕಯಾದುವನ್ನು ಬ್ರಹ್ಮಪುತ್ರ ಬಂದು ಆಗ
    ದೈತ್ಯರಾಜ ಹಿರಣ್ಯ ಕಶಿಪುವಿಗೆ ಒಪ್ಪಿಸಿದನು ||೪||
    ನವಮಾಸಗಳು ತುಂಬಲು ಕಯಾದು ಆಗ ಪುತ್ರರತ್ನವನ್ನು ಪಡೆದಳು
    ನಾಮಕರಣವನ್ನು ಮಾಡಿ ವಿಪ್ರರನ್ನು ಕರೆಸಿ ಬೇಗ
    ದೈತ್ಯ ತನ್ನ ಸುತನಿಗೆ ಪ್ರಹ್ಲಾದನೆಂದು ಕರೆಸಿದನು ||೫||
    ಬಾಲಚಂದ್ರನಂತೆ ಹೊಳೆಯುತ ಇರುತಿರಲು ಐದುವರ್ಷ ತುಂಬಿತಾಗಲೆ
    ಗುರುಗಳನ್ನು ಕರೆಸಿ ಬೇಗ ಸಕಲ ವಿದ್ಯೆಗಳನ್ನು ಕಲಿಸಿರೆಂದು
    ಗುರುಗಳಿಗೆ ಮಗನನ್ನು ಒಪ್ಪಿಸಿದ ದೈತ್ಯ ತಾನು ||೬||
    ಓಂ ನಮಶ್ಶಿವಾಯ ಎನುತ ಅಸುರ ತನ್ನ ಸುತನ ಬರೆದು ತೋರು ಎನ್ನಲು
    ನರಹರಿಯ ನಾಮವನ್ನು ನಗುನಗುತಲೆ ಬರೆಯುತಿರಲು
    ಎಡದ ತೊಡೆಯ ಮೇಲಿಂದ ಶಿಶುವ ಬಡಿದು ಧರೆಗೆ ನೂಕಿದನು ||೭||
    ಸುತ್ತ ಜನರ ಕರೆಸಿ ಬೇಗದಿ ಅಸುರ ತನ್ನ ಸುತನ ಕೊಲಿಸ ಬೇಕು ಎಂದಾಗ
    ಅತ್ತ ಅಡವಿಯೊಳು ವಿಷವನಿಟ್ಟು ಭೋಜನಗಳಮಾಡಿ
    ಹರಿಯ ಸ್ಮರಣೆ ಮಾತ್ರದಿಂದ ಭುಂಜಿ ತಿಳಿದ ಜಟ್ಟಿಹಾಂಗೆ ||೮||
    ಅಂಭುಧಿಯೊಳು ಮಗನ ಮಲಗಿಸಿ ಮೇಲೆ ದೊಡ್ಡ ಬೆಟ್ಟವನ್ನಿಟ್ಟು ಬನ್ನಿರೋ
    ಹರಿಯ ಕೃಪೆಗೆ ವಶನಾದ ತರಳನೆಂದು ವರುಣದೇವ
    ಮರಣ ಇಲ್ಲದ್‍ಹಾಗೆ ಮಾಡಿ ಮನೆಗೆ ಕೊಟ್ಟು ಕಳುಹಿದನು ||೯||

    ಬೆಟ್ಟದಿಂದ ಕಟ್ಟಿ ಉರುಳಿಸಿ ಅಸುರ ಪಟ್ಟದಾನೆ ಕಾಲಲಿ ಮೆಟ್ಟಿಸಿ
    ಉರಿಯುವ ಒಲೆಯ ಮಾಡಿ ಸುಟ್ಟು ಹುಲಿಯಬೋನಿನಲ್ಲಿ ಇಟ್ಟು
    ಯತ್ನವಿಲ್ಲದೆ ಸುತನ ಕೊಲ್ಲಲು ಶಕ್ತನಲ್ಲದೆ ಪೋದನಂತೆ ||೧೦||
    ನಿನ್ನ ದೇವ ಇದ್ದಯೆಡೆಯನು ತೋರುಯೆನುತ ಪಿತನು ತನ್ನ ಸುತನ ಕೋರಲು
    ಯೆನ್ನ ದೇವ ಇಲ್ಲದಂಥ ಯೆಡೆಗಳುಂಟೆ ಲೋಕದಲ್ಲಿ
    ಕಂಭದಲ್ಲು ಇರುವನೆಂದು ಕೈಯ ಮುಗಿದು ತೋರ್ದನಾಗ ||೧೧||
    ನರಹರಿ ನರಹರಿ ಬಾ ಬಾ
    ನರಹರಿ ನರಹರಿ ಬಾ ಬಾ
    ವರಕಂಭವನ್ನು ವೊದೆಯಲು ನರಹರಿಯು ಉಗ್ರ ಕೊಪವನ್ನು ತಾಳಿದ

    ಸತ್ಯಮ್ ವಿಧಾತುಮ್ ನಿಜಭೃತ್ಯಭಾಶಿತಮ್ ವ್ಯಾಪ್ತಿಮ್ ಚ ಭೂತೇಶ್ವಖಿಲೇಶು ಚಾತ್ಮನಃ|
    ಅದ್ಯಸ್ಯತಾತ್ಯಧ್ಭುತರೂಪಮುಧ್ವಹನ್ ಸ್ತಂಭೆ ಸಭಾಯಾಮ್ ನ ಮೃಗಮ್ ನ ಮಾನುಷಮ್||

    ಕಟಕಟೆಂಬ ಧ್ವನಿಯ ಮಾಡಿ ನಖಗಲಿಂದ ಪಿಡಿದು ಒತ್ತಿ
    ಕರುಳ ಬಗೆದು ಮಾಲೆ ಹಾಕಿ ಕಂದ ಭಕ್ತನಪ್ಪಿಕೊಂಡ ||೧೨||
    ಅಂತರಿಕ್ಷದಲ್ಲಿ ಅಮರರು ನೋಡಿ ಆಗ ಪುಷ್ಪವೃಷ್ಟಿಯನ್ನೆ ಕರೆದರು
    ಅಜನ ಪಡೆದ ದೇವಿ‍ ಬಂದು ತೊಡೆಯ ಮೇಲೆ ಕುಳಿತಿರಲು
    ಅಮರಪತಿಯರೆಲ್ಲ ನೋಡಿ ಅಂಜ ಬೇಡೆಂಬಭಯ ಕೊಟ್ಟ ||೧೩||
    ಲಕ್ಷ್ಮೀ ನರಸಿಂಹ ಚರಿತೆಯ ಉದಯ ಕಾಲ ಪಠಿಸುವಂತ ನರರಿಗೆಲ್ಲ
    ಪುತ್ರಸಂತಾನಂಗಳಿತ್ತು ಮತ್ತೆ ಬೇಡಿದ್‍ಹಾಂಗೆ ಕೊಟ್ಟು
    ಭಕ್ತವತ್ಸಲ ಮುಕುತಿ ಕೊಡುವ ಪುರಂದರ ವಿಠಲ ರಾಯ ||೧೩||

    Reply

  118. Posted by P.S.Thammanna on December 11, 2015 at 11:24 am

    There seems to be two versions. Both are here!
    ರಾಗ: ಸುರಟಿ- ಆದಿತಾಳ
    ನರಸಿಂಹನೆಂಬೊ ದೇವರು | ನಂಬಿದಂಥ | ನರರಿಗೆಲ್ಲ ವರವ ಕೊಡುವನು ||ಪ|| ಓಂ ನಮಃ ಶಿವಾಯ ಎನುತಲಿ | ಅಸುರ ತನ್ನ | ಸುತನ ಬರೆದು ತೋರು ಎಂದಾಗ ನರಹರಿ ನಾಮವನ್ನು ನಗುತಲೆ ಬರೆಯುತಿರಲು ಭೂಪತೊಡೆಯ ಮೇಲೆ ಶಿಶುವ ಧರೆಗೆ ಬಡೆದು ನೂಕಿದನು ||೧|| ಸುತ್ತು ಜನರ ಕರೆಸಿಬೇಗದಿಂ ಅರಸು ತನ್ನ | ಸುತನ ಕೊಲ್ಲಿಸಬೇಕೆಂದಾಗ | ಅಟ್ಟ ಅಡವಿಯೊಳ್ ವಿಷವ ನಿಟ್ಟ ಭೋಜನಂಗಳ ಮಾಡೆ | ಹರಿಯ ಸ್ಮರಣೆ ಮಾಡುತಲೇ ಕುಂಜಿ ತಿಳಿದ ಜಟ್ಟಿ ಹಾಂಗೆ ||೨|| ಅಂಭುಧಿಯೋಳ್ ಮಗನ ಮಲಗಿಸಿ | ಮೇಲೆ ದೊಡ್ಡ | ಬೆಟ್ಟವನ್ನು ಇಟ್ಟು ಬನ್ನಿರೊ | ಹರಿಯ ಕೃಪೆಗೆ ವಶನಾದ ತರಳನೆಂದು ವರುಣದೇವ | ಮರಣ ಇಲ್ಲದ್‍ಹಾಗೆ ಮಾಡಿ ಮನೆಗೆ ಕಳುಹಿದನು ||೩|| ಬೆಟ್ಟದಿಂದ ಕಟ್ಟಿ ಉರುಳಿಸಿ ತನ್ನ | ಪಟ್ಟದಾನೆ ಕಾಲಲಿ ಮೆಟ್ಟಿಸಿ | ಹರಲು ಮನೆಯ ಮಾಡಿ ಸುಟ್ಟು ಹುಲಿಯ ಬೋನಿನಲ್ಲಿ ಇಟ್ಟು | ಯತ್ನವಿಲ್ಲದೆ ಸುತನ ಕೊಲ್ಲಲಿಕ್ಕೆ ಶಕ್ತನಲ್ಲದೆ ಪೋದನಂತೆ ||೪|| ನಿನ್ನ ದೇವ ಇದ್ದ ಎಡೆಯನು ತೋರು | ಎನುತ ಪಿತನು ತನ್ನ ಸುತನ ಕೋರಲು | ಎನ್ನ ದೇವ ಇಲ್ಲದಂಥ ಎಡೆಗಳುಂಟೆ ಲೋಕದಲ್ಲಿ | ಕಂಭದಲ್ಲಿ ಇರುವನೆಂದು ಕೈಮುಗಿದು ತೋರ್ವನಾಗ ||೫|| ವರ ಕಂಭವನ್ನು ಒದೆಯಲು ನರಹರಿಯು | ಉಗ್ರರೂಪವನ್ನು ತಾಳಿ | ಕಟಕಟೆಂಬ ಧ್ವನಿಯ ಮಾಡಿ ನಖಗಳಿಂದ ಪಿಡಿದು ಒತ್ತಿ | ಕರುಳ ಬಗೆದು | ಮಾಲೆ ಹಾಕಿ ಕಂದ ಭಕ್ತನಪ್ಪಿಕೊಂಡ ||೬|| ಅಂತರಿಕ್ಷದಲ್ಲಿ ಅಮರರು | ನೋಡಿ ಆಗ | ಪುಷ್ಪವೃಷ್ಟಿಯನ್ನೆ ಕರೆಯಲು | ಅಜನ ಪಡೆದ ದೇವಿ ಬಂದು ತೊಡೆಯಮೇಲೆ ಕುಳಿತುಕೊಂಡು | ಅಮರಪತಿಯರೆಲ್ಲ ನೋಡಿ ಅಂಜಬೇಡೆಂಬಭಯ ಕೊಟ್ಟು ||೭|| ಲಕ್ಷ್ಮೀನಾರಸಿಂಹನ ಚರಿತ್ರೆಯು | ಉದಯಕಾಲ | ಪಠಿಸುವಂಥ ನರರಿಗೆಲ್ಲ | ಪುತ್ರಸಂತಾನಗಳಿತ್ತು ಮತ್ತು ಬೇಡಿದ್‍ಹಾಗೆ ಕೊಟ್ಟು | ಭಕ್ತವತ್ಸಲ ಮುಕ್ತಿ ಕೊಡುವ ಪುರಂದರ ವಿಠಲರಾಯ ||೮||

    ನರಸಿಂಹನೆಂಬೋ ದೇವರು ನಂಬಿದಂಥ ನರರಿಗೆಲ್ಲ ವರವ ಕೊಡುವನು ||
    ಆದಿಯಲ್ಲಿ ಲಕ್ಷ್ಮಿ ಸಹಿತ ಮಲಗಿರಲು ಬಂದರಾಗ ಸನತ್ಕುಮಾರರು
    ಆಗ ದ್ವಾರಪಾಲಕರು ತಡೆಯಲಾಗ ಕೋಪದಿಂದ
    ಮೂರುಜನ್ಮದಲ್ಲಿ ನೀವು ಅಸುರರಾಗಿ ಪುಟ್ಟಿರೆಂದು ||೧||
    ದಿತಿಯ ಗರ್ಭದಲ್ಲಿ ಜನಿಸಿದ ಹಿರಣ್ಯಾಕ್ಷ ಹಿರಣ್ಯಕಶಿಪುರೆಂಬ ಭ್ರಾರ್ತರು
    ಪೃಥಿವಿಯನ್ನು ಮುಳುಗಿಸಿದ ಕಾರಣ ಶ್ರೀ ಹರಿಯು ತೃತಿಯ
    ರೂಪದಿಂದ ಖಳನಕೊಂದು ಧರೆಯನುಳುಹಿದನು ||೨||
    ಅನುಜನಾದ ಹಿರಣ್ಯಾಕ್ಷನ ಮರಣವನ್ನು ಕೇಳಿ ಆಗ ನಡೆದ ತಪಸಿಗೆ
    ಹರಿಯ ಮೇಲೆ ಸಿಟ್ಟಿನಿಂದ ಉಗ್ರ ತಪಸ್ಸನ್ನು ಮಾಡಿ
    ಬ್ರಹ್ಮನಿಂದ ವರಗಳನ್ನು ಪಡೆದುಕೊಂಡು ಬಂದನಾಗ ||೩||
    ಇಂದ್ರಲೋಕ ಸೂರೆಮಾಡಿದ ಮೂರು ಲೋಕಕೆ ಆಸುರತನ್ನ ಭಯವ ತೋರಿದ
    ಗರ್ಭಿಣಿ ಕಯಾದುವನ್ನು ಬ್ರಹ್ಮಪುತ್ರ ಬಂದು ಆಗ
    ದೈತ್ಯರಾಜ ಹಿರಣ್ಯ ಕಶಿಪುವಿಗೆ ಒಪ್ಪಿಸಿದನು ||೪||
    ನವಮಾಸಗಳು ತುಂಬಲು ಕಯಾದು ಆಗ ಪುತ್ರರತ್ನವನ್ನು ಪಡೆದಳು
    ನಾಮಕರಣವನ್ನು ಮಾಡಿ ವಿಪ್ರರನ್ನು ಕರೆಸಿ ಬೇಗ
    ದೈತ್ಯ ತನ್ನ ಸುತನಿಗೆ ಪ್ರಹ್ಲಾದನೆಂದು ಕರೆಸಿದನು ||೫||
    ಬಾಲಚಂದ್ರನಂತೆ ಹೊಳೆಯುತ ಇರುತಿರಲು ಐದುವರ್ಷ ತುಂಬಿತಾಗಲೆ
    ಗುರುಗಳನ್ನು ಕರೆಸಿ ಬೇಗ ಸಕಲ ವಿದ್ಯೆಗಳನ್ನು ಕಲಿಸಿರೆಂದು
    ಗುರುಗಳಿಗೆ ಮಗನನ್ನು ಒಪ್ಪಿಸಿದ ದೈತ್ಯ ತಾನು ||೬||
    ಓಂ ನಮಶ್ಶಿವಾಯ ಎನುತ ಅಸುರ ತನ್ನ ಸುತನ ಬರೆದು ತೋರು ಎನ್ನಲು
    ನರಹರಿಯ ನಾಮವನ್ನು ನಗುನಗುತಲೆ ಬರೆಯುತಿರಲು
    ಎಡದ ತೊಡೆಯ ಮೇಲಿಂದ ಶಿಶುವ ಬಡಿದು ಧರೆಗೆ ನೂಕಿದನು ||೭||
    ಸುತ್ತ ಜನರ ಕರೆಸಿ ಬೇಗದಿ ಅಸುರ ತನ್ನ ಸುತನ ಕೊಲಿಸ ಬೇಕು ಎಂದಾಗ
    ಅತ್ತ ಅಡವಿಯೊಳು ವಿಷವನಿಟ್ಟು ಭೋಜನಗಳಮಾಡಿ
    ಹರಿಯ ಸ್ಮರಣೆ ಮಾತ್ರದಿಂದ ಭುಂಜಿ ತಿಳಿದ ಜಟ್ಟಿಹಾಂಗೆ ||೮||
    ಅಂಭುಧಿಯೊಳು ಮಗನ ಮಲಗಿಸಿ ಮೇಲೆ ದೊಡ್ಡ ಬೆಟ್ಟವನ್ನಿಟ್ಟು ಬನ್ನಿರೋ
    ಹರಿಯ ಕೃಪೆಗೆ ವಶನಾದ ತರಳನೆಂದು ವರುಣದೇವ
    ಮರಣ ಇಲ್ಲದ್‍ಹಾಗೆ ಮಾಡಿ ಮನೆಗೆ ಕೊಟ್ಟು ಕಳುಹಿದನು ||೯||

    ಬೆಟ್ಟದಿಂದ ಕಟ್ಟಿ ಉರುಳಿಸಿ ಅಸುರ ಪಟ್ಟದಾನೆ ಕಾಲಲಿ ಮೆಟ್ಟಿಸಿ
    ಉರಿಯುವ ಒಲೆಯ ಮಾಡಿ ಸುಟ್ಟು ಹುಲಿಯಬೋನಿನಲ್ಲಿ ಇಟ್ಟು
    ಯತ್ನವಿಲ್ಲದೆ ಸುತನ ಕೊಲ್ಲಲು ಶಕ್ತನಲ್ಲದೆ ಪೋದನಂತೆ ||೧೦||
    ನಿನ್ನ ದೇವ ಇದ್ದಯೆಡೆಯನು ತೋರುಯೆನುತ ಪಿತನು ತನ್ನ ಸುತನ ಕೋರಲು
    ಯೆನ್ನ ದೇವ ಇಲ್ಲದಂಥ ಯೆಡೆಗಳುಂಟೆ ಲೋಕದಲ್ಲಿ
    ಕಂಭದಲ್ಲು ಇರುವನೆಂದು ಕೈಯ ಮುಗಿದು ತೋರ್ದನಾಗ ||೧೧||
    ನರಹರಿ ನರಹರಿ ಬಾ ಬಾ
    ನರಹರಿ ನರಹರಿ ಬಾ ಬಾ
    ವರಕಂಭವನ್ನು ವೊದೆಯಲು ನರಹರಿಯು ಉಗ್ರ ಕೊಪವನ್ನು ತಾಳಿದ

    ಸತ್ಯಮ್ ವಿಧಾತುಮ್ ನಿಜಭೃತ್ಯಭಾಶಿತಮ್ ವ್ಯಾಪ್ತಿಮ್ ಚ ಭೂತೇಶ್ವಖಿಲೇಶು ಚಾತ್ಮನಃ|
    ಅದ್ಯಸ್ಯತಾತ್ಯಧ್ಭುತರೂಪಮುಧ್ವಹನ್ ಸ್ತಂಭೆ ಸಭಾಯಾಮ್ ನ ಮೃಗಮ್ ನ ಮಾನುಷಮ್||

    ಕಟಕಟೆಂಬ ಧ್ವನಿಯ ಮಾಡಿ ನಖಗಲಿಂದ ಪಿಡಿದು ಒತ್ತಿ
    ಕರುಳ ಬಗೆದು ಮಾಲೆ ಹಾಕಿ ಕಂದ ಭಕ್ತನಪ್ಪಿಕೊಂಡ ||೧೨||
    ಅಂತರಿಕ್ಷದಲ್ಲಿ ಅಮರರು ನೋಡಿ ಆಗ ಪುಷ್ಪವೃಷ್ಟಿಯನ್ನೆ ಕರೆದರು
    ಅಜನ ಪಡೆದ ದೇವಿ‍ ಬಂದು ತೊಡೆಯ ಮೇಲೆ ಕುಳಿತಿರಲು
    ಅಮರಪತಿಯರೆಲ್ಲ ನೋಡಿ ಅಂಜ ಬೇಡೆಂಬಭಯ ಕೊಟ್ಟ ||೧೩||
    ಲಕ್ಷ್ಮೀ ನರಸಿಂಹ ಚರಿತೆಯ ಉದಯ ಕಾಲ ಪಠಿಸುವಂತ ನರರಿಗೆಲ್ಲ
    ಪುತ್ರಸಂತಾನಂಗಳಿತ್ತು ಮತ್ತೆ ಬೇಡಿದ್‍ಹಾಂಗೆ ಕೊಟ್ಟು
    ಭಕ್ತವತ್ಸಲ ಮುಕುತಿ ಕೊಡುವ ಪುರಂದರ ವಿಠಲ ರಾಯ ||೧೩||

    Reply

  119. Posted by Madhura on December 10, 2015 at 11:39 pm

    Hi,

    Can you please share the lyrics of ‘Prahlada charitra’ composed by Sri Purandaradasaru ( Narasimhavemba devana)?

    Reply

  120. Posted by P.S.Thammanna on November 29, 2015 at 10:57 am

    ಗುಣವಾಯಿತೆನ್ನ ಭವರೋಗ
    {ಶ್ರೀಹರಿ ಸ್ತುತಿ- ಚತುರೋಕ್ತಿ}

    ರಾಗ: ಹಿಂದೂಸ್ತಾನಿ ಕಾಪಿ
    ತಾಳ: ಆದಿ
    ಗುಣವಾಯಿತೆನ್ನ ಭವರೋಗ
    ಕೃಷ್ಣನೆಂಬ ವೈದ್ಯನು ದೊರಕಿದನು
    ಗುಣವಾಗುವವರಿಗೆ ಎಣೆಯಿಲ್ಲ
    ಗುಣವಂತರಾಗುವರು ಭವವೆಲ್ಲ. ||ಪ||

    ಸಂತತ ಹರಿಭಕ್ತಿಯನುಪಾನ
    ಸಂತತ ಗುರುಭಕ್ತಿ ಮರುಪಾನ
    ಸಂತತ ಶ್ರವಣ ಕಠಿಣ ಪಥ್ಯ
    ಸಂತತ ಕೀರ್ತನ ಉಷ್ಣೋದಕ ||೧||

    ಚಂದ್ರೋದಯ ಉಂಟು ಈತನಲಿ
    ಚಿಂತಾಮಣಿಯುಂಟು ಈತನಲಿ
    ಸಂಚಿಯೊಳಗೆ ತುಂಬ ಮಾತ್ರೆಗಳುಂಟು
    ಚೆನ್ನಾಗಿ ಗುಣಮಾಡುವನೀತ ||೨||

    ಗುರುಸ್ಮರಣೆಯು ಶುಂಠಿ ಮೆಣಸು
    ಹರಿದಿವ್ಯನಾಮವು ಸಾರನ್ನ
    ಗುರುಪಾದಸೇವೆಯು ಸಿಹಿ ಸಾರು
    ಹರಿಪಾದೋದಕವೇ ಘೃತವು ||೩||

    ಸಹಸ್ರನಾಮದಿ ತಾ ವಂದ್ಯ
    ಸಕಲ ಸ್ವತಂತ್ರಕೆ ತಾ ಬಾಧ್ಯ
    ಹರಿಸರ್ವೋತ್ತಮನೆಂಬ ವೈದ್ಯ
    ಪುರಂದರವಿಠಲನೆ ನಿಜವೈದ್ಯ ||೪||

    Reply

  121. Posted by Lakshman on November 28, 2015 at 9:20 am

    Please post the lyrics here. Thanks.

    Reply

  122. Posted by Lakshman on November 28, 2015 at 9:17 am

    P.S.Thammanna: Please post the lyrics here. Thanks.

    Reply

    • Posted by P.S.Thammanna on November 29, 2015 at 10:54 am

      ಗುಣವಾಯಿತೆನ್ನ ಭವರೋಗ
      {ಶ್ರೀಹರಿ ಸ್ತುತಿ- ಚತುರೋಕ್ತಿ}

      ರಾಗ: ಹಿಂದೂಸ್ತಾನಿ ಕಾಪಿ
      ತಾಳ: ಆದಿ
      ಗುಣವಾಯಿತೆನ್ನ ಭವರೋಗ
      ಕೃಷ್ಣನೆಂಬ ವೈದ್ಯನು ದೊರಕಿದನು
      ಗುಣವಾಗುವವರಿಗೆ ಎಣೆಯಿಲ್ಲ
      ಗುಣವಂತರಾಗುವರು ಭವವೆಲ್ಲ. ||ಪ||

      ಸಂತತ ಹರಿಭಕ್ತಿಯನುಪಾನ
      ಸಂತತ ಗುರುಭಕ್ತಿ ಮರುಪಾನ
      ಸಂತತ ಶ್ರವಣ ಕಠಿಣ ಪಥ್ಯ
      ಸಂತತ ಕೀರ್ತನ ಉಷ್ಣೋದಕ ||೧||

      ಚಂದ್ರೋದಯ ಉಂಟು ಈತನಲಿ
      ಚಿಂತಾಮಣಿಯುಂಟು ಈತನಲಿ
      ಸಂಚಿಯೊಳಗೆ ತುಂಬ ಮಾತ್ರೆಗಳುಂಟು
      ಚೆನ್ನಾಗಿ ಗುಣಮಾಡುವನೀತ ||೨||

      ಗುರುಸ್ಮರಣೆಯು ಶುಂಠಿ ಮೆಣಸು
      ಹರಿದಿವ್ಯನಾಮವು ಸಾರನ್ನ
      ಗುರುಪಾದಸೇವೆಯು ಸಿಹಿ ಸಾರು
      ಹರಿಪಾದೋದಕವೇ ಘೃತವು ||೩||

      ಸಹಸ್ರನಾಮದಿ ತಾ ವಂದ್ಯ
      ಸಕಲ ಸ್ವತಂತ್ರಕೆ ತಾ ಬಾಧ್ಯ
      ಹರಿಸರ್ವೋತ್ತಮನೆಂಬ ವೈದ್ಯ
      ಪುರಂದರವಿಠಲನೆ ನಿಜವೈದ್ಯ ||೪||

      Reply

  123. Suuuuuuuuuuuuper……

    Reply

  124. Posted by P.S.Thammanna on November 22, 2015 at 3:47 am

    There is a kIrthane starting with gunavayitu…. but it is by Krishna not by Rama! Any way I am sending by mail the available one.
    P.S.Thammanna

    Reply

  125. Posted by ROOPA SURESH PAI on November 22, 2015 at 2:33 am

    Dear Nanjunda,

    Please find the below lyrics of the bhajan for your ref

    GUNAWAAYITHENNA BHAVA… ROGA
    KRISHNA NEMBA VAIDYA DORAKIDENO
    GUNAVAAGUVVAVARIGE YENEYILLA
    GUNA VANTHANAAGUVARU AVARELLA…(GUNA)

    SANTHATHA HARI BHAKTHI ANUPAANA
    SANTHATA GURU BHAKTHI MARUPAANA
    SANTHATA SHRAVANA KATINA PATTHYA……..(2)
    SANTHATA KEERTHANA.. USHNODAKA….

    SAHASRA NAAMADI THAAVANDHYA
    SAKALA SWATHANTHRAKKE THAA VAADHYA
    HARI SARVOTHAMA YEMBA VAIDYA……..(2)
    PURANDAHARA VITTALAKKE NIRAVADHYA…. (GUNA)

    Reply

  126. Posted by nanjunda on November 21, 2015 at 6:07 pm

    Excellent work! Do you have the lyrics of the purandara dasara kriti – “Gunavaayithu yenna bhava roga, rama nembo vaidyanu dorakidanu”?

    Please share it.

    Reply

  127. Posted by sudha on November 2, 2015 at 4:55 am

    hare srinivasa you are great! i need a favour for me. can you give the lyrics of prahlad charithra in Tamil lipi.

    Reply

  128. Posted by Ravichandran S S on October 7, 2015 at 11:11 am

    Please post the lyrics of Kalyanam Thulasi Kalyanam composed by Purandaradasar.

    Reply

  129. Posted by Shubhakar on September 30, 2015 at 2:09 pm

    hari alare hari alare, santa sange brahmanandu alare lyrics require

    Reply

  130. Posted by Manjunath kotegar on September 27, 2015 at 2:09 pm

    hii, can I get the lyrics of nudi manave Shiva namavali

    Reply

  131. Posted by Lakshman on September 17, 2015 at 11:31 am

    Roopa Suresh: Is an audio clip link available for the song nene manavE?

    Reply

    • Posted by ROOPA SURESH PAI on September 28, 2015 at 6:00 am

      Hi Meera,

      Request you to provide me the lyrics of the below bhajans in english:
      1, JAGADEESHWARI BARAMMA CHITTA MANDIRAKKE BARAMMA
      2,SUNDARA MURUTHI MUKYAPRAANA BANDA NAMMA MANEGE
      3,JAI JAI RAMKRISHNA HARI BHEEJA MANTRA THA UCCHARI JAI JAI RAM KRISHNA HARI

      Reply

  132. Posted by Lakshman on September 17, 2015 at 10:52 am

    Corrections welcome.

    kAma dhAma samsara visarali hari bhajani rangali rAdhikA
    gOkuLa vadanE rAdhA vEri samsArAci mAyA sODun
    jagavEgaLE chanda AvaDi kunjavani rAdhikA pAhili
    hari bhajanAnE suTalI bandhana mukta rAdhikA rAlE pAvana
    gOkuLa banalE maga nandanavana vAjavi tO murali vAdana
    AtmarUpa sE rUpa haricE marma magaLe samsArAcE
    dhanya rAdhikA tinE pAhilE vishva svarUpe mUrti sAvaLi

    Reply

  133. Posted by ROOPA SURESH PAI on September 15, 2015 at 3:41 am

    HI Meera,
    Request you to provide me the lyrics of the below bhajans in english:

    1.NENE MANAVE NEENU KRISHNA KRISHNA YENDU(SAMMADHI SADHANA IN KANNADA)
    2. KAAM DHAAM SAMSARAVISARALE HARI BHAJANE RANGALE RAADHIKA

    Reply

  134. Posted by Lakshman on September 14, 2015 at 11:07 am

    P: jai jai kuladEvatA jai jai kuladEvatA jai jai kuladEvatA jai jai kuladEvatA
    A: mahAlakSmi mahAmAyE mahA mahEshvari shAntErikA mAtE durgA dayA kari amcEri
    C1: mahAlatA kAtyAyani shAntAdurgA nArAyaNi vijayi varAhi vaiSNavi shAmbhavi bhavAni
    puNDOdari shItambari shankari sarvEshvari caNDamuNDa mardhini vijayAmbikA vishvEshvari
    2: rAmanAthu dAmOdaru sapta kOTIshvaru pANEshvaru nArasimhu bhairavu bhayankaru
    mangEshu nAgEshu dEvaki krSNa ravaLa nAthu lakSmInArAyaNu gaNapati vEtALu karucu

    Reply

  135. Posted by ROOPA SURESH PAI on September 14, 2015 at 4:58 am

    HI Meera,

    Request you to provide me the lyrics of the below bhajans in english:
    1. jay jay kuladevatha
    2.hari bhajane rangale raadhika

    Reply

  136. Posted by Lakshman on September 12, 2015 at 12:22 pm

    Corrections welcome:

    shloka: pUjaya rAghavEndrAya satya dharma rathayaca bhajata kalpavrkSaya namatA kAmadhEnu

    guru rAhavEndrara. rAgA: yamunAkalyANi. rUpaka tALA.

    P: guru rAghavEndrara caraNa kamalada darushanada bhAgyavu idu
    A: raghu caraNagaLa guru kamala nayanavu sparshitida samayavu idu
    C1: guru karuNe mantrAlayadali tungeyante hariyalu
    kAmakrOdha vEdadadaLiti hrdayadi mUla rAmana nelisida
    2: hanumantanAgi shrI rAmanannu antarangadi nelisida
    aSTadik nigaLanu saubhAgyadinda akSatayente nIlita
    3: tuLasiya vanadali rAghavEndraru vanamAliya kandaru
    tuLasiya tIrthava tanda yatigaLu caitanyava tandaru

    Reply

  137. Posted by rekha on August 31, 2015 at 8:49 am

    mam /sir can anyone give me the lyrics of guru raghavendrara charana kamaladha darushandha bhagyavu idhu plz plz

    Reply

  138. Posted by P>S.Thammanna on August 28, 2015 at 7:17 am

    Madame
    Now that I have procured three volumes of Haridasa songs by AraLumallige Parthasarathi sir and H.R.SatyanarayaNa, in addition to my other collections, I can help you in posting most of the songs in South Indian languages, Devanagari and English also. I may require one day for response..
    Will it be OK
    P.S.T

    Reply

  139. Posted by Lakshmi viswanath on July 20, 2015 at 3:30 am

    Madam I’m very fortunate to have come across to your blog of many household devanamams. Thank you. Madam please can you update the lyrics for Amma baramma, the song goes like Amma baramma, namma thayi baramma, Amma baramma namma devi baramma||
    Thankyou in advance

    Reply

  140. Posted by Lakshman on June 27, 2015 at 11:21 am

    I don’t know kannaDa but I listened to this song and wrote down the lyrics. Corrections welcome.

    hariya kareda rAghavEndrA. rAgA: candrakauns. Adi tALA.

    P: hariya kardeda rAghavEndra hariya kareda rAghavEndrA
    A: hariya kareda shrI narahariya priya aruhalu shrI hari mahimeya jagadi
    C1: mandagudiya pitanandu uddharisalu indirE arasanE kambadi bAyendu
    2: acala bhaktige shrI hariyoli eneyendu acaleyeli tori hariyedu nIyendu
    3: karava mugidu nInagE sharaNadavarigE harasu karuNeyalli nArasimha nIyendu

    Reply

  141. Posted by Lakshman on June 25, 2015 at 9:08 am

    jayatu jaya viThalA. rAgA: mOhana. Adi tALA.

    P: jayatu jaya viThalA ninna nAmavu shAnt dhAmavu saukhyadA rAmA
    C1: pAvanAnga paNDharinAtha padasEvA priyavanitA karuNisi bArayya
    darushana tArayyA nI enna bhAgyadayyA pANDuranga pANDurangayyA
    2: kanasu manasina jIvavu nInE antarAtma bhAvavu nInE
    anyavu illaiyyA elavu nInayyA tUta enda mATidayyA pANDurangA pANDurangayyA

    Reply

  142. Posted by Ram on June 19, 2015 at 5:47 am

    Can someone write the lyrics of old Panduranga song “jayathu Jaya Vitala” In English. Ram

    Reply

    • Posted by Lakshman on June 25, 2015 at 9:04 am

      sAku sAku manuja. rAgA: kAmavardhani/varALi. rUpaka tALA. Kanakadasa.

      P: sAku sAku manuja sEveyu rangayya innu sAku sAku manuja sEve mADi daNidu nonde nAnu
      A: bEku ninna pAda bhajane koTTu salaho rangayya hoTTAreddu hOgi parara
      citta vrttiyannu tiLidu haTTiriddu halavu kelasa bhyatyanante mADi rikta hasthadinda
      maneya sEruve AsegAgi matte kanda kaDege tolaguve bandu apa
      C1: rAtriyalli tindu oraguve rangayya ranga snAna sandhAnuSTAna
      nEmavella toredu biTTu hInanAgi keTTa janara manegaLannu tirugi tirugi tirugi
      shvAnanante dinavu kaLeveno durAseyannu manadalliTTukoNDu kuDiveno
      2: konegO eLLukALinaSTu sukhava kANenO rangayya ranga oDalinAsegAgi
      noNunu tuduki biddu jEninoLage miDukananthe bAyi biDuve bisaruhAkSane
      bidisu enna pAsha bandhava dOSa dora kAgineleyAdi kEshava kanakadAsa-
      noDeya venkatAdri mAdhava rangayya ranga

      Reply

  143. Posted by d.n.salian on May 28, 2015 at 2:18 am

    Please fwd the kannada bhakti song “Hariya kareda raghavendra” in kannada lyrics
    e-mail;salian123456@yahoo.com

    Reply

  144. Posted by K S Anil Kumar on May 20, 2015 at 11:12 pm

    Hi,

    If you have songs lyrics on lord Narasimha please send to me. my mail id is anilkumar.ksmurthy@gmail.com

    Reply

  145. Posted by Aditya Raichhur on May 18, 2015 at 7:34 am

    Only three Word for your Divine Work …………. GOD BLESS YOU!! (your family too)..
    Hare Shrinivasa! 🙂

    Reply

  146. Posted by vandana rao on April 27, 2015 at 9:22 am

    Could not find Mahime peluve keliri either as lyrics or on YouTube. Please update.

    Reply

  147. Posted by geetha on April 14, 2015 at 5:45 am

    madam the songs are very very nice and its really good listen and sing, please upload some songs which we can sing on the occasion of marriage so its useful for many many peoples

    Reply

  148. Posted by Thammanna on March 3, 2015 at 5:29 am

    ಎಲ್ಲರಿಗಾಗಿ!
    ನಿನ್ನ ಭಕುತಿಯನು ಬೀರೋ | ದೇವ| ಎನ್ನ ಮನ್ನಿಸಿ ಸಲಹುವರಾರೋ||ಪ|| ಸನ್ನುತ ಸನ್ಮಾರ್ಗ ತೋರೋ || ಪ್ರ | ಸನ್ನ ರಕ್ಷಕ ಬೇಗ ಬಾರೋ ||ಅ|| ಪನ್ನಗ ಶಯನ ಲಕ್ಷ್ಮೀಶ | ವೇದ | ಸನ್ನುತಪಾದ ಸರ್ವೇಶ || ಇನ್ನು ಬಿಡಿಸೋ ಮೋಹ ಪಾಶ | ಆ | ಪನ್ನ ರಕ್ಷಕ ಶ್ರೀನಿವಾಸ ||೧|| ನಾರದ ಗಾನವಿಲೋಲ | ಸ್ವಾಮಿ | ಭೂರಿ ಭಕ್ತರ ಪರಿಪಾಲ | ಭೂರಮಣ ಕರುಣಾಲವಾಲ | ನವ | ನೀರದಶ್ಯಾಮ ಗೋಪಾಲ ||೨|| ಕರಿರಾಜವರದಾಪ್ರಮೇಯ | ಎನ್ನ | ಅರಿತು ಪಾಲಿಸು ಯೋಗಿಧ್ಯೇಯ || ಸುರಮುನಿ ಹೃದಯನಿಕಾಯ | ಗುರು | ಪುರಂದರ ವಿಠಲರೇಯ ||೩||

    Reply

  149. Posted by d.n.salian on March 2, 2015 at 4:01 am

    pls send the lyrics bhajan ‘NINNA BHAKUTI BEERO DEVA”

    Reply

  150. Posted by prashanth on January 28, 2015 at 1:15 pm

    nice work

    Reply

  151. Posted by prashanth on January 28, 2015 at 1:13 pm

    Greatful to one who is behind the hard work nd motivation keep up the work going gudluck …..

    Reply

  152. Posted by RAGHAVENDRA RAO TATIKOLA on January 19, 2015 at 3:42 am

    MADHWA NAMAVALI POSTED WRONGLY MENTIONED DATE 26-01-2015 INSTEAD OF 28-01-2015

    Reply

  153. Posted by RAGHAVENDRA RAO TATIKOLA on January 19, 2015 at 3:39 am

    26-01-2015 మధ్వనవమి నాడు శ్రీమదానంద తీర్థుల అర్చనకు – మధ్వ నామావళి

    ఓం శ్రీ మధ్వాచార్యాయ నమః

    ఓం శ్రీ వాసుదేవాయ నమః

    ఓం శ్రీ అమానవ నవాకృతయే నమః

    ఓం శ్రీ విష్ణుదాసాయ నమః

    ఓం శ్రీ హరిపదాయ నమః

    ఓం శ్రీ పృథు ధియే నమః

    ఓం శ్రీ వసుదేవ సుతాహ్వయాయ నమః

    ఓం శ్రీ చతురధియే నమః

    ఓం శ్రీ త్రిజగద్గురవే నమః

    ఓం శ్రీ భువనభర్త్రే నమః

    ఓం శ్రీ ద్విజకుమారాయ నమః

    ఓం శ్రీ ఛలమానుషాయ నమః

    ఓం శ్రీ గురవే నమః

    ఓం శ్రీ ద్విజసూనవే నమః

    ఓం శ్రీ త్రిభువన గురవే నమః

    ఓం శ్రీ జగద్గురవే నమః

    ఓం శ్రీ విభవే నమః

    ఓం శ్రీ విశ్వవిదే నమః

    ఓం శ్రీ అలయ బుద్ధయే నమః

    ఓం శ్రీ పూర్ణబోధాయ నమః

    ఓం శ్రీ మహానుతయే నమః

    ఓం శ్రీ భూరిచేతసే నమః

    ఓం శ్రీ మహాహృదే నమః

    ఓం శ్రీ భూరి హృదే నమః

    ఓం శ్రీ అమిత బుద్ధయే నమః

    ఓం శ్రీ అదభ్ర చేతసే నమః

    ఓం శ్రీ ఆనందతీర్థాయ నమః

    ఓం శ్రీ గురుబుద్ధయే నమః

    ఓం శ్రీ అఖండధియే నమః

    ఓం శ్రీ అనుమాన తీర్థాయ నమః

    ఓం శ్రీ సుఖతీర్థాయ నమః

    ఓం శ్రీ గరిష్ఠధియే నమః

    ఓం శ్రీ పూర్ణచేతసే నమః

    ఓం శ్రీ బృహన్మతయే నమః

    ఓం శ్రీ మహామానసాయ నమః

    ఓం శ్రీ మధ్వాయ నమః

    ఓం శ్రీ సం మోదతీర్థాయ నమః

    ఓం శ్రీ హంసరాజాయ నమః

    ఓం శ్రీ ప్రమోదతీర్థాయ నమః

    ఓం శ్రీ సమగ్రధియే నమః

    ఓం శ్రీ ఆర్యవర్యాయ నమః

    ఓం శ్రీ సుచిత్తాయ నమః

    ఓం శ్రీ చారుధియే నమః

    ఓం శ్రీ కృతాంతవిత్తమాయ నమః

    ఓం శ్రీ పూర్ణబుద్ధయే నమః

    ఓం శ్రీ మహాత్మనే నమః

    ఓం శ్రీ పూర్ణధియే నమః

    ఓం శ్రీ ప్రభవే నమః

    ఓం శ్రీ మహామనసే నమః

    ఓం శ్రీ అమందధియే నమః

    ఓం శ్రీ స్వానందతీర్థాయ నమః

    ఓం శ్రీ వ్యూఢ హృదే నమః

    ఓం శ్రీ విస్తృత చిత్తాయ నమః

    ఓం శ్రీ శుద్ధధియే నమః

    ఓం శ్రీ సకలజ్ఞాయ నమః

    ఓం శ్రీ అలయచేతసే నమః

    ఓం శ్రీ పృథుథియే నమః

    ఓం శ్రీ సూరిమౌలయే నమః

    ఓం శ్రీ పృథులచేతసే నమః

    ఓం శ్రీ సర్వవిదే నమః

    ఓం శ్రీ యతయే నమః

    ఓం శ్రీ పూర్ణదృశే నమః

    ఓం శ్రీ పుష్టబుద్ధయే నమః

    ఓం శ్రీ విశంకటబుద్ధయే నమః

    ఓం శ్రీ మరుదంశాయ నమః

    ఓం శ్రీ అమందమనీషాయ నమః

    ఓం శ్రీ అఘనాశనకీర్తయే నమః

    ఓం శ్రీ ప్రచురథియే నమః

    ఓం శ్రీ పురుసంఖ్యాయ నమః

    ఓం శ్రీ జగద్గురవే నమః

    ఓం శ్రీ సం పూర్ణసంఖ్యాయ నమః

    ఓం శ్రీ విశ్వేశచేతసే నమః

    ఓం శ్రీ విద్యాధిపతయే నమః

    ఓం శ్రీ పరిపూర్ణ ప్రమతయే నమః

    ఓం శ్రీ మహాధియే నమః

    ఓం శ్రీ అమితప్రమతయే నమః

    ఓం శ్రీ పురుధియే నమః

    ఓం శ్రీ గురుమానసాయ నమః

    ఓం శ్రీ అనంత హృదే నమః

    ఓం శ్రీ ఋజుపుంగవాయ నమః

    ఓం శ్రీ అమితాంతరాయ నమః

    ఓం శ్రీ ప్రభూతధియే నమః

    ఓం శ్రీ భూరితరమానసాయ నమః

    ఓం శ్రీ అమరాది సద్గణాయ నమః

    ఓం శ్రీ అవిరలాంతరాయ నమః

    ఓం శ్రీ మహాసుఖతీర్థాయ నమః

    ఓం శ్రీ విరలేతరాంతరాయ నమః

    ఓం శ్రీ ధీరమతయే నమః

    ఓం శ్రీ సౌఖ్యతీర్థాయ నమః

    ఓం శ్రీ కవయే నమః

    ఓం శ్రీ లోకనాయకాయ నమః

    ఓం శ్రీ ప్రాజ్ఞ మౌళిమణయే నమః

    ఓం శ్రీ పృథులమానసాయ నమః

    ఓం శ్రీ సర్వధియే నమః

    ఓం శ్రీ అదభ్ర మనీషాయ నమః

    ఓం శ్రీ వృషదధివాంశాయ నమః

    ఓం శ్రీ శుద్ధహృదే నమః

    ఓం శ్రీ ఉత్తమచిత్తాయ నమః

    ఓం శ్రీ సద్గురవే నమః

    ఓం శ్రీ వృజిననాశననామ్నే నమః

    ఓం శ్రీ ఆనందధియే నమః

    ఓం శ్రీ విశ్వవేత్త్రే నమః

    ఓం శ్రీ పరాత్మవేదకాయ నమః

    ఓం శ్రీ వితానచేతసే నమః

    ఓం శ్రీ పృథుప్రబోధాయ నమః

    ఓం శ్రీ మహిష్ఠహృదయాయ నమః

    ఓం శ్రీ మహీయోమతయే నమః

    ఓం శ్రీ వృష్ణవాగ్రసరాయ నమః

    ఓం శ్రీ జగదీశాయ నమః

    ఓం శ్రీ మహాపురుషోత్తమదాసాయ నమః

    ఓం శ్రీ ధన్యప్రవరాయ నమః

    ఓం శ్రీ ప్రాజ్ఞాయ నమః

    ఓం శ్రీ అదీనసత్వాయ నమః

    ఓం శ్రీ అనంతగుణాంతరాయ నమః

    ఓం శ్రీ గురుప్రబర్హాయ నమః

    ఓం శ్రీ వ్యాసశిష్యాయ నమః

    ఓం శ్రీ అజసమాయ నమః

    ఓం శ్రీ ధ్వస్తదురాగమాయ నమః

    ఓం శ్రీ అయామహృదే నమః

    ఓం శ్రీ అలేశధియే నమః

    ఓం శ్రీ పూర్ణసంఖ్యాయ నమః

    ఓం శ్రీ పూజ్యచరణాయ నమః

    ఓం శ్రీ దశప్రమతయే నమః

    ఓం శ్రీ బహులధియే నమః

    ఓం శ్రీ విస్తృతాంతరాయ నమః

    ఓం శ్రీ మహిషధియే నమః

    ఓం శ్రీ అనంత స్వాంతాయ నమః

    ఓం శ్రీ వేదాంత సిం హాయ నమః

    ఓం శ్రీ భూరిచిత్తాయ నమః

    ఓం శ్రీ హర్ష తీర్థాయ నమః

    ఓం శ్రీ విద్వద్వర్యాయ నమః

    ఓం శ్రీ ఉత్తమప్రీతితీర్థాయ నమః

    ఓం శ్రీ ఆచార్యవర్యాయ నమః

    ఓం శ్రీ గోవింద భక్తాయ నమః

    ఓం శ్రీ ధన్యబుద్ధయే నమః

    ఓం శ్రీ ప్రాజ్యప్రజ్ఞాయ నమః

    ఓం శ్రీ విస్తారబుద్ధయే నమః

    ఓం శ్రీ అగ్ర్యానందతీర్థాయ నమః

    ఓం శ్రీ హర్యంశాయ నమః

    ఓం శ్రీ సర్వవిదే నమః

    ఓం శ్రీ అదభ్ర ధిషణాయ నమః

    ఓం శ్రీ అమితమతిపదాయ నమః

    ఓం శ్రీ గురుమతయే నమః

    ఓం శ్రీ పృధుదర్శనాయ నమః

    ఓం శ్రీ యోగినే నమః

    ఓం శ్రీ విష్ణుసుహృదే నమః

    ఓం శ్రీ భువన విభూషణాయ నమః

    ఓం శ్రీ హరిపద రతాయ నమః

    ఓం శ్రీ ప్రచురాంతరాయ నమః

    ఓం శ్రీ భగవత్తమాయ నమః

    ఓం శ్రీ విపుల ప్రమతయే నమః

    ఓం శ్రీ మహనీయపాదాయ నమః

    ఓం శ్రీ అమానవకలాయ నమః

    ఓం శ్రీ మహానందతీర్థాయ నమః

    ఓం శ్రీ గూఢదేవాయ నమః

    ఓం శ్రీ పరిపూర్ణమతయే నమః

    ఓం శ్రీ ప్రచురప్రజ్ఞాయ నమః

    ఓం శ్రీ బహులబోధాయ నమః

    ఓం శ్రీ బహులప్రబోధాయ నమః

    ఓం శ్రీ దశహృదయాయ నమః

    ఓం శ్రీ ఉరుచేతసే నమః

    ఓం శ్రీ పరమాగ్ర్యానందతీర్థాయ నమః

    ఓం శ్రీ బహులహృదే నమః

    ఓం శ్రీ కృత్యవేదిప్రవేకాయ నమః

    ఓం శ్రీ విపులహృదయాయ నమః

    ఓం శ్రీ అమృతాన్నసేవ్యాయ నమః

    ఓం శ్రీ సహస్రప్రకాశాయ నమః

    ఓం శ్రీ పృథుమతయే నమః

    ఓం శ్రీ అఖిలజ్ఞాయ నమః

    ఓం శ్రీ ప్రాజ్ఞదివాకరాయ నమః

    ఓం శ్రీ పరమానంద సుతీర్థసూరి రాజాయ నమః

    ఓం శ్రీ వ్రతిరాజాయ నమః

    ఓం శ్రీ ప్రాణపతయే నమః

    ఓం శ్రీ శతసంఖ్యాయ నమః

    ఓం శ్రీ పురుషరత్నాయ నమః

    ఓం శ్రీ త్రిజగత్పూజ్యాయ నమః

    ఓం శ్రీ అనంతమానసాయ నమః

    ఓం శ్రీ ప్రబర్హబోధాయ నమః

    ఓం శ్రీ విశ్వాభిజ్ఞాయ నమః

    ఓం శ్రీ అతుచ్ఛధిషణాయ నమః

    ఓం శ్రీ చక్రాయుధప్రియాయ నమః

    ఓం శ్రీ భూయోధియే నమః

    ఓం శ్రీ మహాచార్యాయ నమః

    ఓం శ్రీ మారుతాంశాయ నమః

    ఓం శ్రీ వేదవాదిరాజే నమః

    ఓం శ్రీ ఉర్వీక్షాయ నమః

    ఓం శ్రీ బ్రహ్మసమాయ నమః

    ఓం శ్రీ ప్రీతితీర్థాయ నమః

    ఓం శ్రీ వేదాంతగురవే నమః

    ఓం శ్రీ అనంతమతయే నమః

    ఓం శ్రీ పవనాంశాయ నమః

    ఓం శ్రీ మహాబోధాయ నమః

    ఓం శ్రీ కృత్స్నజ్ఞాయ నమః

    ఓం శ్రీ అపరిమితమనీషాయ నమః

    ఓం శ్రీ అలపబోధాయ నమః

    ఓం శ్రీ మాన్యధియే నమః

    ఓం శ్రీ సమధికధిషణాయ నమః

    ఓం శ్రీ అధికబోధాయ నమః

    ఓం శ్రీ సన్మతిమతే నమః

    ఓం శ్రీ ప్రచురతరహృదే నమః

    ఓం శ్రీ అధికధిషణాయ నమః

    ఓం శ్రీ అతనుమనసే నమః

    ఓం శ్రీ పరిపూర్ణసంవిదే నమః

    ఓం శ్రీ భూయోబోధాయ నమః

    ఓం శ్రీ విశ్వజ్ఞాయ నమః

    ఓం శ్రీ అఖండజ్ఞాయ నమః

    ఓం శ్రీ సర్వజ్ఞాయ నమః

    ఓం శ్రీ పరమమతయే నమః

    ఓం శ్రీ విపులహృదే నమః

    ఓం శ్రీ సంపూర్ణప్రమతయే నమః

    ఓం శ్రీ అదభ్రసంఖ్యాయ నమః

    ఓం శ్రీ బృహద్ధియే నమః

    ఓం శ్రీ శుచిహృదే నమః

    ఓం శ్రీ విశాలసంవిదే నమః

    ఓం శ్రీ ప్రపూజ్యపూజ్యాయ నమః

    ఓం శ్రీ సుచేతసే నమః

    ఓం శ్రీ ప్రాజ్యేక్షాయ నమః

    ఓం శ్రీ వేదప్రవచనాచార్యాయ నమః

    ఓం శ్రీ అనంతబోధాయ నమః

    ఓం శ్రీ పూర్ణేక్షాయ నమః

    ఓం శ్రీ రామప్రియాయ నమః

    ఓం శ్రీ సదర్చ్యాయ నమః

    ఓం శ్రీ అనూనబోధాయ నమః

    ఓం శ్రీ వితతమతయే నమః

    ఓం శ్రీ ఉచ్ఛమానాయ నమః

    ఓం శ్రీ మహేక్షాయ నమః

    ఓం శ్రీ యతివరాయ నమః

    ఓం శ్రీ సకలమతయే నమః

    ఓం శ్రీ ప్రచురాంతరాయ నమః

    ఓం శ్రీ ఉరుమతయే నమః

    ఓం శ్రీ బృహత్ప్రబోధాయ నమః

    ఓం శ్రీ భువనగురవే నమః

    ఓం శ్రీ దశధిషణాయ నమః

    ఓం శ్రీ ఆర్యవర్యాయ నమః

    ఓం శ్రీ అవిరలసంవిదే నమః

    ఓం శ్రీ ప్రచురమనోవిలాసాయ నమః

    ఓం శ్రీమదానంద తీర్థాయ నమః

    Reply

  154. Posted by priti prabhu on January 15, 2015 at 9:58 pm

    I am very thankful to get such collection here.request you to find karkala padu tirupati bhajan. ..

    Reply

  155. Posted by Tulasi on January 15, 2015 at 5:12 am

    Dear Meera..

    I just started learning singing..as I was going through to collect some lyrics I found your website, I was so delighted to see your service and concern towards our culture. I found most of the lyrics in your web itself, thank you so much. If u could help me the Aarathi song for the couples offering Pooja it would be very helpful..

    Thank you
    Regards

    Reply

  156. Posted by ananth on October 5, 2014 at 12:50 pm

    kindly send lyrics in english of “Lakshmi Narayana – jaya – Lakshmi Narayana” song by sri.vadiraja to me . my email id is ‘ulliyar@gmail.com’

    Reply

  157. Posted by Hari Prasad on October 1, 2014 at 6:45 am


    Namaste… Relly appreciate your work.. very helpful can you please give me a link and lyrics of 1) Savadhanadindiru manave devaru kottanu kottanu..
    2) Krishna Krishna Krishna yendu mooru baari neneyiro

    Reply

  158. Posted by Jayasimha Raghavendra on September 23, 2014 at 2:12 am

    How to find “Narasimha nenbo devanu Nambidantha Nararigella Varava Kuduvanu”

    I need lyrics please help me….

    Reply

  159. Posted by Siri on August 30, 2014 at 6:26 am

    Hi,
    I am Siri. can you please post the lyrics of ” Hanumantha Hanumatha Song by Rachuir Sheshagiridas” ….

    Reply

  160. Posted by Asha on August 26, 2014 at 8:45 am

    Hi Meera,

    Can you please share lyrics of aidu beralu seri ondu mushtiyu

    Reply

  161. Posted by Arun on August 19, 2014 at 5:09 am

    please send Guru guna stavana Lyrics & audio

    Reply

  162. Posted by Anand on August 16, 2014 at 8:17 am

    This is an absolutely amazing collection of songs. Thanks for this Meera Madam. Have one request. Do you have the lyrics of the song : Enna Swaami Jagadantaryaami by Sri Jagannatha ViThala Dasaru. If so, can you please share the lyrics Madam? Thank you.

    Reply

  163. Posted by Capt M.S. Rammohan on August 14, 2014 at 12:01 am

    Hi Meeraji
    Could you please send the lyrics of Narasimha Geete (sung by Shri Vidyabhushana) in Tamil script. Thank you.
    Kind Regards
    Capt M.S. Rammohan

    Reply

  164. Posted by lekshmy on August 9, 2014 at 12:07 am

    Hi Meera,

    How do i submit lyrics for a song?

    I have lyrics for ” Munjaane yeddu govinda yenni, namma najioa dhrithavu dhooraayenni”

    Reply

  165. Posted by Priya on August 5, 2014 at 6:48 am

    Dear Meera or other readers,
    May I get the lyrics and meaning of the songs
    Indendu Vachchithira…
    and Adigo Baruthi hane sri rama…
    Your help much appreciated. Thank you, Priya

    Reply

  166. Posted by Shilpa on August 5, 2014 at 4:31 am

    Nimma prayathna thumba chennagide… Hage munduvaresi…. Nanage ”Mangala mahagowri ranga sahodari” hadina lyrics sigabahuda?

    Reply

    • Posted by meeraghu on August 5, 2014 at 7:35 pm

      No idea about that song.

      Reply

    • Posted by Nandini on August 2, 2016 at 8:21 am

      hi,
      I got the lyrics from my grandma. Happy singing:)
      ಮಂಗಳ ಮಹಾಗೌರಿ ರಂಗನ ಸಹೋದರಿ
      ಗಂಗಾಧರನ ರಾಣಿ ಶ್ರೀಗೌರಿ||

      ಮೂತಿನ ಮೂಗುತಿ ಕೊಡೆ
      ರತ್ನದ ವಾಲಿ ಕೊಡೆ
      ಮುತೈದೆ ತನ ಕೊಟ್ಟು ಕಾಪಾಡೆ||

      ವಂಕಿ ಬಳೆ ಕೊಡೆ
      ಕಂಕಣ್ಣ ಋಣಿ ಕೊಡೆ
      ಕುಂಕುಮ ಅರಿಶಿನ ಕೋಟು ಕಾಪಾಡೆ||

      ಪರಿಮಳದ ಪುಷ್ಪ ಕೊಡೆ
      ಜರತಾರಿ ಸೀರೆ ಕುಪ್ಪಸ ಕೊಡೆ
      ತರುಣಿಯರೊಡಗೂಡಿ ಮಾತಾಡೆ||

      ಅನ್ನ ವಸ್ತ್ರವ ಕೊಡೆ
      ಚಿನ್ನದ ಹೊನ್ನು ಕೊಡೆ
      ಸಡಗರ ಸಂಪಾತು ಕೊಟ್ಟು ಕಾಪಾಡೆ||

      Reply

    • Posted by Nandini on August 2, 2016 at 9:28 am

      youtube link of my grandma singing it, https://youtu.be/tIJ-9Wy3oBQ

      Reply

  167. Posted by suma on July 29, 2014 at 3:24 am

    please can one share me belaguvenu aruthiya mahalakshimige lyrics.

    Reply

  168. Posted by Lavanya on July 17, 2014 at 1:20 am

    Can u pls post the lyrics of Shri Jayatheerathara Suprabhatam and the stotra which starts like ‘Kripe maadi pore tande Jayatheertha guruve…’?

    Reply

  169. Posted by Mahadeva Prasad on July 3, 2014 at 4:35 am

    Daari Kaanadagide Raaghavendrane…
    Singer: Vani Jayaraam…
    Movie: Deepa…

    Daari Kaanadagide Raaghavendrane
    Belaka Thori nedesu baa yogivaryanee…. || Daari ||

    Manada Aase thilisuvaase heege helali
    Naale heege yemba chinte indu edeyali
    Kallu mullu eene irali baala haadiyali
    Ninna karuneinda ella sumagalaagali…. || Daari ||

    Yaara yaara serisuveyo yaaru ariyaru
    Yaara nagisi alisuveyo yaaru ballaru
    Neenu kunisidante taane ella kunivru
    Neenu jyothi biriya Manna Hanate ellaru…. || Daari ||

    Reply

  170. Posted by Veena on June 17, 2014 at 6:42 am

    nodu nodu nithihall chamundi kannada songs

    Reply

  171. Posted by Ravi on June 9, 2014 at 5:47 am

    Dear Meera Madam,

    I got the lyrics of the song “swamy mukyaprana” from your blog.

    Thank you for your great service.

    Reply

  172. Posted by Ravi on June 9, 2014 at 5:29 am

    Maanyare,

    I need the lyrics of the following song.
    “Swamimukhya prana
    Nina marevara gantala gaana
    Hididyo ramara charana
    Nee haud haud haud jaga trana”

    pl. upload

    Reply

  173. Posted by K S Anil Kumar on May 26, 2014 at 9:57 pm

    hI
    Hi…….

    If you have BALLAVARU YARILLA SRIKRISHNANA BALLAVARU BAHALILLA SRIKRISHNAN song lyrics, could you please upload

    Reply

  174. Posted by Rajasree on May 14, 2014 at 4:57 pm

    Request to you Meera Please could you upload the lyrics for Kolu Kolanna Kole sung by Mysore Ramachandra ji which gives details of DashaAvtara of Shree Krishna Bhagvan, at the earliest please

    Reply

    • Posted by Lakshman on June 24, 2014 at 2:40 pm

      kolu kOlenna kolu. rAgA: shankarAbharaNa. Adi tALA. Anantadrishadasa.

      P: kOlu kOlenna kOlu muttina kOlu kOlenna
      A: kOlu kOlanADuva banni bAla vEnkaTapati lIle koNDADutali
      C1: parama dayALu hari bhrugu muni bharadindodeyutire tirugi kAl~hiDakoNDu para pari stutisidA
      2: parama cancala lakSmI tA shrIhari naDateya nODi sahisade kollApurake naDedaLu
      3: siri illade nAnU obbane iralaarenu endu hari vaikuNThadim dharegiLidanu
      4: uttama vaikuNTha iralu matturagAdriyali huttu maneya mADi guptadalirutiha
      5: nitya nirvikAra shrIhari bhaktara abhimAni nettiya oDakoNDu bhaktara saluhida
      6: bhuava rOgada vaidyA tA eni suvanu guruvanu kareda avaninda tale gAyavanu kaLedanu
      7: bhUramaNa varaha dEvana bhUmiya tA bEDi svAmi puSkariNI sIme sAdhisida
      8: nOTadinda celuva tA bahu mATa kudure Eri thATininda mruga bETege naDedanu
      9: vanavana sancarisi allo bavniteyaLanu kaNDa manasiTTanu A vaniteya mEle
      10: A vaniteyu kanyA tApadmAvatiyenisuvaLu hUvige banda lAvanadalle
      11: vArige geLatiyara kUDi vihaAra mADutihaLu sAri tAnaDedanu shrI ramaNanu tA
      12: nADinoLagina rIti ellaru ADuvantha mAtu ADida kallIDyADidaLAga
      13: peTTu taagi kudure prANava biTTitu AgallE biTtA kudureyu beTTavanEri
      14: A mAnini avage mOhisi tA mAtADadale kAma jvaradinda tA malagihaLu
      15: prAntakanantAdri yalliha shAnta mUruti hortu antaranga jvara shAntavAgadu

      Reply

  175. Posted by Rajasree on May 13, 2014 at 12:06 pm

    Please request upload Gubbi ado Gubbi ado Govinda Govinda Gubbi ado song and lyrics by Mysore Ramchandra ji

    Reply

  176. Posted by Sandhya on April 27, 2014 at 1:32 am

    Hii Meera, liked your blog , here is a link to another blog which has lyrics to many songs in Carnatic music. I like the songs u have posted in your blog.
    http://sangeetasagaram.blogspot.in/search/label/Vaadiraja

    Reply

  177. Posted by Vishwanath h on April 26, 2014 at 10:26 pm

    Hi madam

    Reply

  178. Posted by vishwanathvi on April 26, 2014 at 10:23 pm

    Plz send the lyrics of ahudo hanumanthani ahudo balavanta n indivara nayane govindanyake barane n send the songs too to my gmail..plzzz do send..dieing for them..m big fan of dasara padagalu plzz do send…tq

    Reply

  179. Posted by Seetharam on April 17, 2014 at 2:05 am

    Dear All,

    If you have kannada lyrics Hakkiya Hegaleri…..please please post it

    Thanks in advance

    Seetharam

    Reply

  180. Posted by Sneha on April 16, 2014 at 11:26 am

    hello madam,
    do u have the lyrics for the song “yestu sahasavanta” on Lord hanuma in kannada?
    if yes please send the lyrics to my ID.
    hope u find it!!
    -DIVYASNEHA

    Reply

    • Posted by meeraghu on April 16, 2014 at 7:20 pm

      I will post it soon. Please subscribe or visit again to get the lyrics. No personal emails can be sent.

      Reply

  181. Posted by Dhivya R on April 12, 2014 at 2:57 am

    Hello All,
    I was very happy to find the lyrics of yogi manege banda song.. Can someone send me the english transalation of it please. Cause i dont understand kannada very well.

    Thanks and Regards,
    Dhivya.R

    Reply

  182. Posted by Lakshman on April 11, 2014 at 8:17 am

    bAro manege gOvinda. rAgA: madhyamAvati. aTa tALA. Shripadaraya.

    P: bAro manege gOvinda ninnanghri kamalava tOrO enage mukunda
    nalidADu manadali mArapita Ananda nandana kanda
    A: cArutara sharIra karuNA vArinidhi bhavaghOra nAshana
    vArijAsana vandya nIraja sArasadguNa hE ramApatE
    C1: nODO dayadindenna karapaduma shiradali nIDO bhaktaprasanna nalidADo manadali
    bEDikombeno ninna Ananda ghanna mADadiru anumAnava koNDADuvenu tava pAda mahimegaLanu
    jODisuve karagaLanu caraNake kUDiso tava dAsajanaroLu
    2:hEsi viShayagaLalli toLalyADi nA balu klEsha paDuvudu balli ghanayuvatiyara sukha
    lEsu embudanu kolli Ase biDisilli Esu janumada dOSadindali
    Isuvenu idaroLage indige mOsavAyitu AdudAgali shrIsha nI kaipiDidu rakSisu
    3: nIne gatiyenagindu uddhariso bEgane dInajanarige bandhu nA ninna sEvaka
    shrInivaasa endendu kAruNyasindhu prANapati hrudayAbjamaNTapa
    sthAnadoLagabhi vyApta cinmaya dhyAna gOcaranAgi kaNNige kANisuve shrIrangaviThala

    Reply

  183. Posted by Jayasimha Raghavendra on April 11, 2014 at 12:51 am

    did you have “Baro manege Govinda ninnagree kamalava thoro” lyrics please provide

    Reply

  184. Posted by lalitakala on April 3, 2014 at 9:12 am

    Sriinaadha govinda aananda moorutigea
    maaninimaNiyaru beLagidaru aarutiya ll Srii ll
    1.hattu avataaranige rukmiNiya ramaNanigea
    matte deavaki deavi sutanaada Sriiharigea ll Srii ll
    2.dyaana maaLapa janariigea maanadinda kaayuva
    dyaana naayaka namma sutanaada Sriiharigea ll Srii ll
    3.veadagaLa nodida chinmayagea eegalea
    aadi mooruti namma purandharaaviThalagea ll Srii ll

    శ్రీనాధ గొవింద ఆనంద మూరుతిగే
    మానినిమణియరు బెళగిదరు ఆరుతియ ll శ్రీ ll
    1.హత్తు అవతారనిగె రుక్మిణియ రమణనిగే
    మత్తె దేవకి దేవి సుతనాద శ్రీహరిగే ll శ్రీ ll
    2.ద్యాన మాళప జనరీగే మానదింద కాయువ
    ద్యాన నాయక నమ్మ సుతనాద శ్రీహరిగే ll శ్రీ ll
    3.వేదగళ నొదిద చిన్మయగే ఈగలే
    ఆది మూరుతి నమ్మ పురంధరావిఠలగే ll శ్రీ ll

    ಶ್ರೀನಾಧ ಗೋವಿಂದ ಆನಂದ ಮೂರುತಿಗೆ
    ಮಾನಿನಿಮಣಿಯರು ಬೆಳಗಿದರು ಆರುತಿಯ ll ಶ್ರೀ ll
    1.ಹತ್ತು ಅವತಾರನಿಗೆ ರುಕ್ಮಿಣಿಯ ರಮಣನಿಗೆ
    ಮತ್ತೆ ದೆವಕಿ ದೆವಿ ಸುತನಾದ ಶ್ರೀಹರಿಗೆ ll ಶ್ರೀ ll
    2.ದ್ಯಾನ ಮಾಳ್ಪ ಜನರೀಗೆ ಮಾನದಿಂದ ಕಾಯುವ
    ದ್ಯಾನ ನಾಯಕ ನಮ್ಮ ಸುತನಾದ ಶ್ರೀಹರಿಗೆ ll ಶ್ರೀ ll
    3.ವೆದಗಳ ನೋದಿದ ಚಿನ್ಮಯಗೆ ಈಗಲೆ
    ಆದಿ ಮೂರುತಿ ನಮ್ಮ ಪುರನ್ಧರಾವಿಠಲಗೆ ll ಶ್ರೀ ll

    Reply

  185. Posted by suma on March 17, 2014 at 5:24 am

    Please can share me shrinatha govinda aanandha muruthige lyrics.

    Reply

  186. Posted by Madhu. on March 8, 2014 at 2:40 am

    I would very greatful of any one can send me the lyrics of ‘Laali laali hanuma Bheema madhvarya….” laali haadu please. Thanks a lot…!!! Madhu.

    Reply

    • Posted by Srikanth on July 31, 2018 at 8:28 am

      Madhu sir, Did you get the lyrics for ‘Laali laali hanuma Bheema madhvarya….”? Could you please share it, if you have it please!!

      Reply

  187. Posted by P.S.Thammamma on March 7, 2014 at 9:35 am

    I have Lyrics of ShrImadbhagavadgIta (18ch), Vishnu sahasra nAma. If any one interested in these Lyrics typed in BRH.Kannada may contact me.

    Reply

  188. Posted by lalitakala on March 6, 2014 at 9:48 am

    sri gururayara janma dinage nanna eechiru kaanike manthralaya varadanivasa govida om sri raghavendraya namahaa

    Reply

  189. Posted by lalitakala on March 6, 2014 at 9:38 am

    raaghaveandra raayaa Enunimma maayaa
    bhaktariigea sahaayaa maaDuvantha jeeyaa ll raa ll
    tunga bhadra tiira dalli vaasamaaLapa jeeyaa
    bhaktariigea sahaayaa maaDuvantha jeeyaa ll raa ll
    akshatii angaaraa mudriyoLu SRngaaraa
    tuLaseeya haaraa noDiri kaNNaraa ll raa ll
    vaayu putra yanisi vaadigaLa jayisi
    parimaLaarya enisi SriikRshNa raayara poojisi ll raa ll

    రాఘవేంద్ర రాయా ఏనునిమ్మ మాయా
    భక్తరీగే సహాయా మాడువంథ జీయా ll రా ll
    తుంగ భద్ర తీర దల్లి వాసమాళప జీయా
    భక్తరీగే సహాయా మాడువంథ జీయా ll రా ll
    అక్షతీ అంగారా ముద్రియొళు శృంగారా
    తుళసీయ హారా నొడిరి కణ్ణరా ll రా ll
    వాయు పుత్ర యనిసి వాదిగళ జయిసి
    పరిమళార్య ఎనిసి శ్రీకృష్ణ రాయర పూజిసి ll రా ll

    Reply

  190. Posted by Lakshman on February 28, 2014 at 9:35 am

    ईत मुख्य प्राण नाथ. रागा: बेहाग्. अट ताळा. फुरन्दरदसरु.

    प्: ईत मुख्य प्राण नाथ
    अ: ईत श्री राम सॆवकनेनिसिदात
    च्१: भानुविन तुडुकिताग भारतके बन्दाद वानरॊत्तम हनुम हरि शरणनीत
    २: वार्दिहिय नेगेदाग वनॅचराग्रॆसरनीत वारिजाक्षिगे मुद्रिगे वहिसि इत्तात
    ३: लन्किणिय गेलिदात लन्केयनु उरिसिदात पन्कजॊद्भवन पट्ट भद्रनीत
    ४: वानरॊत्तमनीत वसुधेगे वेग्गळनीत दानवान्तक हनुम दश प्रमतियीत
    ५: स्मरनम्बु गेलिदात शरण जनरिगे दात सिरि पुरन्दर विट्टलगे अच्चिन्न भक्तनीत

    Reply

  191. Posted by Srini Ramachandran on February 27, 2014 at 7:10 pm

    can someone please post the lyrics for Eetha Mukhya PraNa naatha by Sri Purandara Dasa in Kannada or Telugu or Sanskrit?

    Reply

  192. Posted by jaya on February 25, 2014 at 9:46 pm

    Namaskarams meera madam. I am Mrs.Jaya aged about 63 years. I am an ardent admirer of you and greatl y appreciate your efforts in helping many lakhs of people like us by devoting your valuable time and giving us many rare songs with lyrics.

    Madam, i would be grateful if you could kindly help me with some of the lyrics of Sri Vadiraja Guru and Kanakadasa songs and also Sri Vidya Prasanna Theertharu. Though i know only tamil and english, you can help me with kannada lyrics so that i can get it translated thru my son

    If u can, can you kindly arrange to post the same by e mail after receiving your response i shall provide my e mail or you may post the lyrics in your blog

    sorry for troubling you madam
    god bless you and your family

    jaya

    Reply

  193. Posted by lalitakala on February 24, 2014 at 5:56 am

    ಹನುಮನ ಮತವೆ ಹರಿಯ ಮತವು
    ಹರಿಯ ಮತವೆ ಹನುಮನ ಮತವು
    ಹನುಮನ ನಂಬಿದ ಸುಗ್ರೀವ ಗೆದ್ದ
    ಹನುಮನ ನಂಬದ ವಾಲಿಯು ಬಿದ್ದ || ೧ ||
    ಹನುಮನ ನಂಬಿದ ವಿಭೀಷಣ ಗೆದ್ದ
    ಹನುಮನ ನಂಬದ ರಾವಣ ಬಿದ್ದ || ೨ ||
    ಹನುಮನು ಪುರಂದರ ವಿಠಲನ ದಾಸ
    ಪುರಂದರ ವಿಠಲನು ಹನುಮನೊಳ್ ವಾಸ || ೩ ||

    హనుమన మతవె హరియ మతవు
    హరియ మతవె హనుమన మతవు
    హనుమన నంబిద సుగ్రీవ గెద్ద
    హనుమన నంబద వాలియు బిద్ద ll 1 ll
    హనుమన నంబిద విభీషణ గెద్ద
    హనుమన నంబద రావణ బిద్ద ll 2 ll
    హనుమను పురందర విఠలన దాస
    పురందర విఠలను హనుమనొళ్ వాస ll 3 ll

    hanumana matave hariya matavu
    hariya matave hanumana matavu
    hanumana naMbida sugrIva gedda
    hanumana naMbada vAliyu bidda || 1 ||
    hanumana naMbida vibhIShaNa gedda
    hanumana naMbada rAvaNa bidda || 2 ||
    hanumanu puraMdara viThalana dAsa
    puraMdara viThalanu hanumanoL vAsa || 3 ||

    Reply

  194. Posted by lalitakala on February 24, 2014 at 5:47 am

    ಗಜವದನ ಬೇಡುವೆ | ಗೌರೀತನಯ
    ಗಜವದನ ಬೇಡುವೆ
    ತ್ರಿಜಗವಂದಿತನೆ ಸುಜನರ ಪೊರೆವನೆ
    ಪಾಶಾಂಕುಶಧರ ಪರಮಪವಿತ್ರ
    ಮೂಷಿಕವಾಹನ ಮುನಿಜನಪ್ರೇಮ ll೧ll
    ಮೋದದಿ ನಿನ್ನಯ ಪಾದವ ತೋರೋ
    ಸಾಧುವಂದಿತನೆ ಆದರದಿಂದಲಿ ll೨ll
    ಸರಸಿಜನಾಭ ಶ್ರೀ ಪುರಂದರವಿಠಲನ
    ನಿರುತ ನೆನೆಯುವಂತೆ ದಯ ಮಾಡೋ ll೩ll

    గజవదన బేడువె | గౌరీతనయ
    గజవదన బేడువె
    త్రిజగవందితనె సుజనర పొరెవనె
    పాషాంకుషధర పరమపవిత్ర
    మూషికవాహన మునిజనప్రేమ ll1ll
    మోదది నిన్నయ పాదవ తోరో
    సాధువందితనె ఆదరదిందలి ll2ll
    సరసిజనాభ శ్రీ పురందరవిఠలన
    నిరుత నెనెయువంతె దయ మాడో ll3ll

    gajavadana bEDuve | gourItanaya
    gajavadana bEDuve
    trijagavaMditane sujanara porevane
    pAshAMkushadhara paramapavitra
    mUShikavAhana munijanaprEma ll 1 ll
    mOdadi ninnaya pAdava tOrO
    sAdhuvaMditane AdaradiMdali ll 2 ll
    sarasijanAbha Srii puraMdaraviThalana
    niruta neneyuvaMte daya mADO ll 3 ll

    Reply

  195. Posted by Lakshman on February 23, 2014 at 10:34 am

    English or dEvanAgari will be fine. Thanks.

    Reply

  196. Posted by lalitakala on February 23, 2014 at 3:38 am

    Please let me know which language to translate from Kannada..

    Reply

  197. Posted by Lakshman on February 19, 2014 at 11:04 am

    I don’t know which songs they are since I don’t read Kannada. Please post the transliteration for any Kannada song that is posted. Thanks.

    Reply

  198. Posted by lalitakala on February 19, 2014 at 5:54 am

    ee mantra laxmi astaka neevu lyrics firest page eight lines haakidiri ade full naanu type telugu nalli type maadi kalisini kannadanalli beakaa

    Reply

  199. Posted by Lakshman on February 18, 2014 at 9:06 pm

    Meearaghu:
    When Kannada lyrics are posted would you be kind enough to post the English transliteration as well. While I have contributed some lyrics here I would also like to make use of some other posted here (ones I don’t have). Thanks.

    Reply

  200. Posted by Jorapur Lalitalaka Pralhad rao on February 18, 2014 at 10:59 am

    శ్రీ
    శ్రీమహాలక్ష్మి అష్టకం
    నమస్తేస్తు మహామాఏ శ్రీపీఠ సురపూజితే శంఖ చక్ర గదా హస్తే మహాలక్ష్మి నమోస్తుతే
    నమస్తే గరుడారూడే కొలాసుర భయంకరి సర్వపాప హరే దేవి మహాలక్ష్మి నమోస్తుతే
    సర్వగ్న సర్వ వరదె సర్వ దుష్ట భయంకరి సర్వపాపహరె దేవి మహాలక్ష్మి నమోస్తుతే
    సిద్ది బుద్ది ప్రదే దేవి భక్తి ముక్తి ప్రదాయని మంత్ర పూజే సదా దేవి మహాలక్ష్మి నమోస్తుతే
    ఆద్యంత రహితే దేవి ఆది శక్తి మహేశ్వరి యోగగ్నే యోగ సంభూతే మహాలక్ష్మి నమోస్తుతే
    స్తూల సూక్షమ మహారౌద్రే మహాశక్తి మహూదరే మహా పాపహరె దేవి మహాలక్ష్మి నమోస్తుతే
    పద్మా సనస్తితే దేవి పర బ్రహ్మ స్వరూపిణి పరమేశి జగన్మాతా మహలక్ష్మి నమోస్తుతే
    శ్వేతాంబరదరే దేవి నానాలంకార భూషితే జగస్తితే జగన్మాతా మహలక్ష్మి నమోస్తుతే
    మహాలక్ష్మి అష్టకం సొత్రం యపఠే భక్తి మాన్నర సర్వ సిద్ది మవాపుత్రి రాజ్యం ప్రపుత్రి సర్వదా
    ఎకకాలే పఠేన్నిత్యం మహా పాప వినాశనం ద్వికాలేయ పఠేన్నిత్యం ధన ధాన్య సమన్వీత
    త్రీకాలయ పఠేన్నిత్యం మహాశత్రు వినాశనం మహాలక్ష్మి భవేన్నిత్యం ప్రసన్నా వరదా శుభా
    ఇతి శ్రీ మహాలక్ష్మి అష్టకం సంపూర్ణం
    శ్రీ కృష్ణర్పణమస్తు

    Reply

  201. Posted by Bhavana on February 17, 2014 at 12:35 pm

    Very beautiful Lalitakala. Thanks a ton. I have converted the same to Kannada font.

    || ಶ್ರೀ ಸತ್ಯಗೀತ ||
    ನಾರಾಯಣಾಯ ಪರಿಪೂರ್ಣಗುಣಾರ್ಣವಾಯ
    ವಿಶ್ವೋದಯಸ್ತೀತಿಲಯೋನಿಯತಿಪ್ರದಾಯ
    ಜ್ಞಾನಪ್ರದಾಯ ವಿಭುಧಾಸುರಸೌಖ್ಯದುಖಃ
    ಸತ್ಕಾರಣಾಯ ವಿತತಾಯ ನಮೋನಮಸ್ತೆ
    ಶ್ರೀ ಗುರುಭ್ಯೊ ನಮಃ
    ಹರಿಃ ಓಂ

    ಜಯ ಸತ್ಯನಾರಾಯಣ ಜಯ ಸತ್ಯಭಾಮೇಶ
    ಜಯ ಸತ್ಯಗಣಪತಿ ಹೇ ಜಯತು ಜಯತು

    ನೈಮಿಶಾರಣ್ಯದಲಿ ಶೌನಕಾದಿಗಳೊಮ್ಮೆ
    ಪ್ರೇಮದಿಂ ಸೂತರನು ಕೇಳಲಾಗ
    ಭೂಮಿಯಲಿ ಬಳಲುತಿಹ ಕಲಿಯುಗದ ಜನಗಳಿಗೆ
    ಕಾಮಿತವ ನೀಡ್ವಂಥ ವ್ರತವ ಪೇಳಿದರು

    ವ್ರತವಿಹುದು ಸತ್ಯನಾರಾಯಣನ ಪೂಜೆಯದು
    ಸತತ ಕಷ್ಟವನೆಲ್ಲ ಪರಿಹರಿಸುವುದದು
    ಕಂತುಪಿತ ನಾರದಗೆ ಪೇಳಿದನು ಮೊದಲಿದನು
    ಚಿಂತಿಸಿದ ಫಲಗಳನು ಕೊಡುವುದಿದುವೆ

    ಭಕ್ತಿಯಿಂದರ್ಚಿಸುತ ಸತ್ಯನಾರಾಯಣನ
    ಉಕ್ತ ವಿಧಿಯಂ ಬಿಡದೆ ವರುಷ ನಾಲ್ಕರೊಳು
    ಶಕ್ತಿಯಿಂದಾಚರಿಸೆ ನಿಯಮದುದ್ಯಾಪನೆಯ
    ಮುಕ್ತಿಯನು ಸುಲಭದಲಿ ಪಡೆಯಬಹುದು

    ವಿಪ್ರನೋರ್ವನು ಭಿಕ್ಷೆಯಿಂದ ಜೀವಿಸುತಿರಲು
    ವಿಪ್ರ ವೇಷದಿ ಬಂದು ಕಾರುಣ್ಯ ಸಿಂಧು
    ಅಪ್ರಮೇಯನು ಪೇಳಲೀ ವ್ರತವನಾಚರಿಸೆ
    ಕ್ಷಿಪ್ರದಲಿ ಸಂಪದವ ಪಡೆದನೆಂದು

    ವಿಪ್ರನೀಪರಿಯಲಿ ವ್ರತವನಾಚರಿಸುತಿರೆ
    ಕಾಷ್ಟ ವಿಕ್ರಯನೋರ್ವ ನೀರಡಿಸಿ ಬಂದು
    ಹೊತ್ತಸೌದೆಯ ಹೊರೆಯ ನಿಳುಹಿ ಪೂಜೆಯಕಂಡು
    ವಿಧಿಯ ನೆಲ್ಲವ ಕೇಳಿದ ತಾಮಾಡಲೆಂದು

    ಸಂಕಲ್ಪವನು ಮಾಡಿ ಕಟ್ಟಿಗೆಯ ಮಾರುತ
    ದ್ವಿಗುಣ ಧನವನು ಪಡೆದು ಭಕ್ತಿಯಿಂದ
    ಸತ್ಯನಾರಾಯಣನ ಪೂಜಿಸುತಲಿಹಪರದಿ
    ಸಕಲ ಸೌಖ್ಯಗಳನು ಪಡೆದನಾಗ

    ರಾಜನುಲ್ಕಾಮುಖನು ಸಂತತಿಯ ಬಯಸುತ
    ವ್ರತವನಾಚರಿಸುತಿರೆ ವರ್ತಕನು ಕಂಡು
    ಮಕ್ಕಳಾದರೆ ತಾನು ವ್ರತವ ಮಾಡುವೆನೆಂದು
    ಹರಕೆಯನು ಹೊತ್ತನಾ ಶೆಟ್ಟಿ ಮನಧೊಳಗೆ

    ಸತಿಯು ಲೀಲಾವತಿಯು ಗರ್ಭವನು ತಾಳಿದಳೈ
    ಸತ್ಯನಾರಾಯಣನ ಕರುಣೆಯಿಂದ
    ಕನ್ಯೆಯನು ಪಡೆದಳಾ ಶಿಶು ಕಳಾವತಿಯಂದು
    ಶುಕ್ಲ ಶಶಿಯಂದದಲಿ ಬೆಳದಳಾಗ

    ವರ್ಷ ತುಂಬಲಿಯೆಂದು ಮದುವೆಸಮಯ
    ದೊಳೆಂದು ವ್ರತವ ಮುಂದೂಡುತಲಿ ಮರೆತನಾಗ
    ಸತ್ಯದೇವನು ತಾನು ಧನಮಧವನಿಳಿಸಲೈ
    ಶಪಿಸಿದನು ದಾರುಣದಿ ಕಷ್ಟ ಬರಲೆಂದು

    ವಾಣಿಜ್ಯ ವೃತ್ತಿಯಿಂದ ರತ್ನಸಾರಪುರಕ್ಕೆ
    ಅಳಿಯನೊಂದಿಗೆ ತೆರಳಿ ದುಡಿಯುತಿರಲು
    ನೃಪ ಚಂದ್ರಕೇತುವಿನ ಧನವ ಚೋರನು ಕದ್ದು
    ತಂದಿವರ ಬಳಿಯಿರಿಸಿ ಕಾಣದಾದ

    ರಾಜದೂತರು ಬಂದು ಬಂಧಿಸಿದರೀರ್ವರನು
    ದೇವಮಾಯೆಯೊಳವರ ಮಾತನಾಲಿಸದೆ
    ಸೆರೆಯೊಳಿಟ್ಟರು ಸಕಲ ಧನಕನಕವಸ್ತುಗಳ
    ಬೊಕ್ಕಸಕೇ ಸುರಿದರು ಲೆಕ್ಕವಿಲ್ಲದಲೆ

    ಇತ್ತ ಲೀಲಾವತಿಯ ಮನೆಗೆ ಕಳ್ಳರು ಹೊಕ್ಕು
    ವಿತ್ತವನ್ನಪಹರಿಸೆ ತಿರಿದುತಿನ್ನುತಲಿ
    ಬಳಲುತಿರೆ ಮಗಳೊಮ್ಮೆ ತಾ ಕಂಡ ಪೂಜೆಯನು
    ವಿವರಿಸಲು ನೆನೆದಳೈ ವ್ರತವ ಬಿಟ್ಟುದನು

    ತಾಯಿಮಗಳಿಬ್ಬರು ಭಕ್ತಿಯಿಂದ ಪೂಜಿಸುತ
    ತಮ್ಮಯಪರಾಧಗಳು ಮನ್ನಿಪುದು ಯೆಂದು
    ತಮ್ಮ ಪತಿಗಳು ಬರಲು ವ್ರತವ ಮಾಡುವೆವೆಂದು
    ಬೇಡೆ ದಯತೋರಿದನು ಕಾರುಣ್ಯಸಿಂಧು

    ಅತ್ತ ಸೆರೆಯೊಳಗಿಟ್ಟ ಬಂಧಿಗಳೀರ್ವನು
    ಬಿಡುತವರ ಧನವ ಕೊಡು ಎಂದು ಕನಸಿನಲಿ
    ಪ್ರಭು ಪೇಳೆ ನೃಪ ಬೆದರಿ ಲೆಕ್ಕವಿರದಲೈ
    ಒಂದಕ್ಕೆ ಹತ್ತಾಗಿ ಕೊಟ್ಟು ಕಳುಹಿದನು

    ದಂಡಿ ವೇಷದಿ ಬಂದು ಪರೀಕ್ಷಿಸಲು ನಾವೆಯೊಳು
    ಸೊಪ್ಪು ಸೌದೆ ಇದೆಂಬುದೆ ಸತ್ಯವಾಯಿತು
    ಕ್ಷಮೆಯ ಬೇಡಲು ಬಳಿಕ ಕೊಟ್ಟನೆಲ್ಲವ ತಿರುಗಿ
    ಊರು ಕಾಣಲು ಮನೆಗೆ ಹೇಳಿ ಕಳುಹಿದನು

    ಪತಿಗಳೈಬಂದರೆಂಬುದ ಕೇಳಿ ಸಂಭ್ರಮದಿ
    ತಾಯಿ ಹೊರಡಲು ಮಗಳು ಪೂಜೆಮುಗಿಸಿ
    ದೇವ ಪ್ರಸಾದವನು ಮರೆಯುತೋಡುತ ನೋಡೆ
    ಪತಿಯು ನಾವೆಸಹಿತ ಕಾಣದವನಾದ

    ಗೋಳಿಟ್ಟು ದೇವನನು ಮೊರೆಹೊಗಲು ಬಾನ್ನುಡಿಯ
    ಕೇಳಿ ಪ್ರಸಾದವನು ಭುಜಿಸಿ ಬರಲು
    ತೇಲಿತಾನಾವೆಯದು ಪತಿಯೊಡನೆ ಭಕ್ತಿಯಲಿ
    ಆಚರಿಸಿ ವ್ರತವನು ಸಕಲ ಸುಖವ ಹೊಂದಿದರು

    ರಾಜ ತುಂಗಧ್ವಜನು ಬೇಟೆಯಾಡುತ ಬಂದು
    ಗೊಲ್ಲರಾಚರಿಸುತಿಹ ವ್ರತವ ಕಂಡು
    ಗರ್ವದಿ ತ್ಯಜಿಸುತ್ತಾ ದೇವ ಪ್ರಸಾದವನು
    ಕಳೆದುಕೊಂಡನು ಸಕಲ ಸಿರಿಯ ಸುತರೊಡನೆ

    ಮದವಳಿಯೆ ಗೊಲ್ಲರೆಡೆಗೈ ಬಂದು ಭಕ್ತಿಯಲಿ
    ವ್ರತವ ಮಾಡುತ ಗೋಪಬಾಲರೊಡನೆ
    ಸುತರೊಡನೆ ಸಿರಿಯ ತಾ ತಿರುಗಿ ಪಡೆದನು ಜಗದಿ
    ಸತ್ಯದೇವನ ಮಹಿಮೆ ಪೇಳಲಸದಳವು

    ||ಶ್ರೀಕೃಷ್ಣಾರ್ಪಣಮಸ್ತು ||

    Reply

  202. Posted by lalitakala on February 17, 2014 at 11:48 am

    శ్రీ సత్యగీత
    నారాయణాయ పరిపూర్ణగుణార్ణవాయ
    విశ్వోదయస్తీతిలయోనియతిప్రదాయ
    జ్ఞానప్రదాయ విభుధాసురసౌఖ్యదుఖః
    సత్కారణాయ వితతాయ నమొనమస్తె
    శ్రీగురుభ్యొనమః
    హరిః ఓం
    జయ సత్యనారాయణ జయ సత్యభామేశ
    జయ సత్యగణపతి ఏ జయతు జయతు

    (1) నైమిశారణ్యదలి శౌనకాదిగళొమ్మె
    ప్రేమదిం సూతరను కేళలాగ
    భూమియలి బళలుతిహ కలియుగద జనగళిగె
    కామితవనీడ్వంథ వ్రతవ పేళిదరు

    వ్రత విహుదు సత్యనారాయణన పూజెయదు
    సతత కష్ట వనెల్ల పరిహరిసువుదదు
    కంతుపిత నారదగె పేళిదను మొదలిదను
    చింతిసిద ఫలగళను కొడువుదిదువె

    భక్తి ఇందర్చిసుత సత్యనారాయణన
    ఉక్త విధియం బిడదె వరుష నాల్కరొళు
    శక్తియిందాచరిసె నియమదుద్యాపనెయ
    ముక్తియను సులభదలి పడెయబహుదు

    విప్రనొర్వను భిక్షయింద జివిసు తిరలు
    విప్ర వేషది బందు కారుణ్య సింధు
    అప్రమెయను పేళలీ వ్రతవ నాచరిసె
    క్షిప్రదలి సంపదవ పడెదనెందు

    (2) విప్రనీపరియలి వ్రతవ నాచరిసుతిరె
    కాష్ట విక్రయ నొర్వనీరడిబందు
    హొత్తసౌదెయ హొరెయ నిళుహి పూజెయకండు
    విధియ నెల్లవ కేళిద తామాడలెందు

    సంకల్పవనుమాడి కట్టిగెయ మారుత
    ద్విగుణ ధనవను పడెదు భక్తి యింద
    సత్యనారాయణన పూజిసుతలిహపరది
    సకల సౌఖ్యగళను పడెదనాగ

    (3) రాజనుల్కాముఖను సంతతియ బయసుత
    వ్రతవనాచరిసుతిరె వర్తకను కండు
    మక్కళాదరె తాను వ్రతవ మాడువెనెందు
    హరికెయను హొత్తనా శెట్టి మనధొళగె

    సతియు లీలావతియు గర్భవను తాళిదళై
    సత్యనారాయణన కరుణెయింద
    కన్యయను పడెదళా శిశు కళావతి యందు
    శుక్ల శశియందదలి బెళదళాగ

    వర్ష తుంబలి యందు మదువెసమయ
    దొళెందు వ్రతవ ముందూడుతలిమరెతనాగ
    సత్యదేవను తాను ధనమధవనిళిసలై
    శపిసిదను దారుణది కష్ట బరలెందు

    వాణిజ్య వృతియింద రత్నసారపురక్కె
    అళియనొందిగె తెరళిదుడియుతిరలు
    నృప చంద్రకేతువిన ధనవ చొరనుకద్దు
    తందివర బళియిరిసి కాణదాద

    రాజదుతరు బందు బందిసిదీర్వను
    దేవమయ యొళవరమాతనాలిసదె
    సెరెయొళిట్టరు సకల ధనకనకవస్తుగళ
    బొక్కసకే సురిదరు లెక్కవిల్లదలె

    ఇత్తలీలావతియ మనెగె కళ్ళరుహొక్కు
    విత్తవన్నపహరిసె తిరిదుతిన్నుతలి
    బళలుతిరె మగళొమ్మె తాకండపుజెయను
    వివరిసలు నెనెదళై వ్రతవ బిట్టుదను

    తాయిమగళిబ్బరు భక్తియిందపూజిసుత
    తమ్మయపరాధగళు మన్నిపుదు యెందు
    తమ్మపతిగళు బరలు వ్రతవు మాడువెయెందు
    బెడె దయతొరిదను కారుణ్యసింధు

    అత్త సెరెయొళగిట్ట బంధిగళీర్వను
    బిడుతవర ధనవ కొడు ఎందు కనసినలి
    ప్రభు పెళె నృపబెదరి లెక్కవిరదలై
    ఒందక్కె హత్తాగి కొట్టు కళుహిదను

    (4) దండి వేషది భందు పరిక్షిసలు నావెయొళు
    సొప్పు సౌదె ఇ దెంభుదె సత్యవాయతు
    క్షమెయ బెడలు బళిక కొట్టనెల్లవ తిరుగి
    ఊరు కాణలు మనెగె హేళి కళుహిదను

    పతిగ ళై భంద రెంభుదకేళి సంబ్రమది
    తాయి హొరడలు మగళు పూజెముగిసి
    దేవ ప్రసాదవను మరెయ తొడుతనొడె
    పతియు నావెసహిత కాణదవనాద

    గొళిట్టు దేవనను మొరెహొగలు బాన్నుడియ
    కేళి ప్రసాదవను భుజిసి బరలు
    తేలితానావెయదు పతియొడనె భక్తి యలి
    ఆచరిసి వ్రతవను సకల సుఖవ హొందిదరు

    (5) రాజ తుంగద్వజను భేటి యాడుత భందు
    గొల్లరాచరిసుతిహ వ్రతవ కండు
    గర్వది త్యజిసుత్తా దేవ ప్రసాదవను
    కళెదు కొండను సకల సిరియ సుతరొడనె

    మదవళియ గొల్లరెడెగై భందు భక్తియలి
    వ్రతవ మాడుత గొపబాల రొడనె
    సుత రొడనె సిరియ తా తిరుగి పడెదను జగది
    సత్యదేవన మహిమె పేళలసదళవు
    శ్రీకృష్ణార్పణమస్తు

    సేవా జొరాపుర్ లక్ష్మి ప్రహల్లాదరావు
    Hyderabad
    Phone 040-27656964
    Cell 9989299314

    Reply

  203. Posted by Lakshman on February 14, 2014 at 7:20 pm

    There are two versions of this song here:
    http://mio.to/#/search/clips/global!q=veni+madhavana

    Reply

  204. vEni mAdhavana tOris Sri Vadirajara Kruthi
    if you have this lyrics can u please share?

    Reply

  205. Posted by Varadaraja on February 9, 2014 at 6:50 am

    Hi meera i cant see PRANA DEVARA MANGALA SHLOKA on main page please post ASAP

    Reply

  206. Posted by vbnandu86Abhinandan on February 8, 2014 at 8:11 am

    Thanks for creating this list!
    Please continue your good work.

    So happy to find everything at one place

    Reply

  207. Posted by jorapurpralhadrao on February 5, 2014 at 11:00 am

    తూగిరె రాయర తూగిరె గురుగళ తూగిరె యతికొల తిలుకర
    తూగిరె యూగింద్ర కరకమల పుజ్యర తూగిరె గురురాఘవేంద్రార ll తూ ll
    కుందణ మయవాద బానతొట్టిలొళు అందది మలగ్యారె తూగిరె
    నందనంద గొవింద ముకుందన అందది భజిపర తూగిరె ll తూ ll
    యొగనిథ్రెయన్ను బేగనే మాడువ యొగిశ వంథ్యార తూగిరె
    భూగిశయననపాద యొగది భగిపర భాగవతరన్న తూగిరె ll తూ ll
    నేమది తానెను కామిప జనరిగె కామిత కొడువవర తూగిరె
    ప్రేమది నిజజనర ఆమయవనకుల ధుమకెతినిపరన తూగిరె ll తూ ll
    అద్వైతమతద విద్వంసన నిజగురు మద్వమతొద్దరన తూగిరె
    శుద్దసంకల్పది భద్దనిజభక్తర ఉద్దర మళ్పర తూగిరె ll తూ ll
    భజకజనర భవథ్యజనె మాడిసి అవర నిజగతి యిప్పర తూగిరె
    నిజగురు జగన్నాద విఠన పదకంజ భజనేయ మాళ్పర తూగిరె ll తూ ll

    PRANA DEVARA MANGALA SHLOKA
    మంగళ ముఖ్య ప్రాణేశగే జయ మంగళ వాయు కుమారనిగే
    అంజని దేవియ కందగే మంగళ కంజాక్షి హనుమంతగే మంగళ
    సంజీవనవ తందాతగే మంగళ సజ్జన పరిపాలగే మంగళ ll మll
    అతిబలవంత శ్రి భిమగే మంగళ ప్రతిమల్లర గెలిదగే మంగళ
    సతియ సిరేయ సెళేయ బందవన పృద్వి మ్యేలె కెడహి దాతగే మంగళ ll మll
    సరస సుశాస్ర్తవ పెళ్ద్దవగె మంగళ నిరుత శ్రీరామర బంటగే మంగళ
    దొరెసిరిక్రిష్ణన పూజెయ మాడువ గురుమద్వమునిరాయగే మంగళ ll మll

    Reply

  208. Posted by Lalitakala on February 3, 2014 at 12:30 pm

    తూగిరె రాయర తూగిరె గురుగళ
    తూగిరె యథికుల థిలకర
    తూగిరె యొగీంద్ర కరకమల పూజయర
    తూగిరె గురు ఋఅఘవెంద్రర ||
    కు0దన మయవద చందద తోటిలదొలు
    నందది మలగ్యర తూగిరె
    నందనకంద గొవింద ముకుందన
    నందది భజిపర తూగిరె ||1||
    యౌగనిద్రెయను బేగనె మాడువ
    Yఒఘిష వంద్యర తూగిరె
    భొగిషయనన పద యొగది భజిపర
    భగవథరన తూగిరె ||2||
    నేమది తనను కమిపజనరిగె
    కమిత కొడువవర తూగిరె
    ప్రెమది నిజజనర ఆమయవనుకూల
    ధూమకెతువెనిపర తూగిరె ||3||
    ఆద్వైథ మథద విద్వషన నిజగురు
    మధ్వమథొధరన తూగిరె
    సిద్ధ సంకల్పది బద్ధ నిజభక్తర
    ఉద్ధరమల్పర తూగిరె ||4||
    భజక జనరు భవ త్రుజన మడిసి అవర
    నిజ్జగథీప్పర తూగిరె
    నిజగురు జగనథవిత్తలన పదకంజ
    భజనెయ మల్పర తూగిరె ||5||

    Reply

  209. Posted by T.Raghavendra Rao, H No.16-2-752/21/7, Triveni Nagar, Gaddiannaram, Hyderabad-500060 Cell:9246160127 on February 2, 2014 at 11:03 am

    It is Madhava Stava Rajam to be recited during Magha masa consisting of about 55 slokas

    Reply

  210. Posted by Anu Kumar on January 29, 2014 at 7:13 am

    Hi Meera

    I think i can call u like that.. No offence please. You are doing a wonderful job for the entire kannada speAking community . My grandmother used to recite this sloka on Lakshmi Narasimha which goes like seela lola manohaara sidda laksmi naarasimha. Can you or any of the bhakta janas get the lyrics for this sloka. Will be very grateful.

    Anu.

    Reply

    • Posted by meeraghu on January 29, 2014 at 7:51 am

      Yes, my name is Meera and that is what I like to be called. 🙂 Not heard of the song. However, many who visit this visit might be able to provide.

      Reply

      • Posted by Raghavendra Rao on January 30, 2014 at 7:13 am

        Respected Meera madam,

        can you give information on Madhava stavarajam

        T. Raghavendra Rao, H.No.16-2-752/21/7, Triveni Nagar Colony, Gaddiannaram, Dilsukhnagar, Hyderabad-500060. Ph:040-2415 1167; Cell:92461 60127

      • Posted by meeraghu on January 30, 2014 at 7:57 am

        What is that?

  211. Posted by Shailaja Anand on January 12, 2014 at 4:09 am

    Namaskara, pl give me the lyrics of song Ranagana Ranige Manjula Venige Anganighabada Bayakegalu

    Reply

  212. Posted by Prasanna L on January 9, 2014 at 4:24 am

    Hi Meera Ji,

    Need lyrics for the song – “Guppiyaado Guppiyaado Govinda” by Sri Vaadhiraja Swamy.

    Regards,
    Prasanna L

    Reply

  213. Posted by Priya on January 6, 2014 at 9:41 pm

    Thank you! Much appreciated.

    Reply

  214. meaning for pAlisamma muddu shAradE:

    Nurture us with fondness,ShAradE
    Do reside in my speech [tongue][p]
    Oh! mother, your eyes are full of affection
    I have always trusted you[a.p]
    You have all the wisdom ingrained in the syllables.
    Fourteen worlds seek refuge in you.
    Manifest in all your glory,accept and protect us.[c1]
    You reside in the city of sringEri,
    You are enthralled by music and singing.
    You posess an auspicious figure.Hail!the consort of Brahma[c2]
    You are well decorated,the embodiment of kindness.
    I sing and praise your glory,Praising guru purandara vittala,[nurture us][c3]

    Reply

  215. Posted by N. Anantha Narayanan on January 3, 2014 at 7:18 am

    hai,

    Do you have the complete lyrics for the song ”

    Hari Narayana, Hari Narayana, Hari Narayana, Hari Narayana,
    Adaiyen seithulla doshangal ellam podi poduthudan kalivanumai,
    adimalaril nin udikinam bakti guruvayur vazhumm bhagavane

    It is ok in case you have this in tamil, malayalam or english. Pls let me know

    Reply

  216. Posted by Srividya on December 12, 2013 at 1:26 am

    Hi…Can anybody post the lyrics of the song “ROMA ROMA KANNINALLI RAMA NAMA…” – a popular song on Hanuman sung by Shri. Puttur Narasimha Nayak?

    Thanks in advance,
    Srividya

    Reply

  217. Dear Madam
    I want the lyrics of sri katyayani mangalam starting Dheera gambheera

    Reply

  218. Posted by Lakshman on December 7, 2013 at 10:33 am

    jO jO yashOdeya. rAgA: Anandabhairavi. Adi tALA.

    P: jO jO yashOdeya nanda mukundane jO jO kams kuThAri
    A: jO jO munigaLa hrdayAnandane jO jO lakumiya ramaNa
    C1: hokkuLa hUvina tAvaregaNNIna ikkida makara kuNDalada
    okkuLisuva kathapina suLiguruLina cikka bAya muddu mogada
    sokkida madakariyandadi nosaloLagikkida kastUri tilaka
    rakkasarededallaNa muravairiye makkaLa mANikya jO jO
    2: kaNNa beLagu pasarisutire gOpi are kaNNa mucci nODi naguta
    saNNa beraLugaLa bAyoLagaLavaDisi pannaga shayana toTTilali
    ninna magana mudda nODu endenutali tanna patige tOridaLu
    honna baNNada sobagina khaNiye hosarannada bombeya jO jO
    3: nIDu tOLgaLa pasarisutire gOpiya toDeya mEl malagi bAidereya
    oDaloLagIrELu bhuvanaviralu kaNDu naDugi kangaLanu muccidaLu
    saDagarisuta tAnariyadandeya hoDEmaraLi mogava nODutali
    kaDala shayana shrI purandara viTTalanu biDade nammellara rakSisuva

    Reply

  219. Posted by Kalamalini on December 7, 2013 at 8:42 am

    Hello Meera,
    Want help in getting lyrics for jo jo yashodaye nanda mukunda in english and its meaning. Got lyrics in kannada, but need it in english. Thanks in advance.

    Reply

  220. Posted by Bhavana on December 4, 2013 at 11:48 pm

    Thanks Nagesh. I think the meaning you gave is correct.

    Reply

  221. ಕುರುವಕ = ಮದರಂಗಿ ಗಿಡ. Not sure if kuruvaka is same as kuruvaga. If same, this could mean ‘ one with the fragrance of this plant’

    Reply

  222. Posted by Bhavana on December 4, 2013 at 8:34 am

    Very beautiful song. Thank you Sir. I have converted it to Kannada.

    Can any one help with the meaning of this word “kuravaga gandhini” in charana 2

    ೧: ಕಮಲ ಕೋಮಲ ಕರತಲ ಲಾಲಿತ ಪಾದ ಪಲ್ಲವ ನೀನಾರೈ ಕೃಷ್ಣ
    ಕಾಮಿನಿ ಭಾಮಿನಿ ರೂಪದ ಚಂದವ ನೋಡಬಂದೆನೆ ಭಾಮೆ ನಾನು ||

    ೨: ನಂದ ನಂದನ ಯದುಕುಲ ವಂದ್ಯನ ಇಂದು ವದನ ನೀನಾರೈ ಕೃಷ್ಣ
    ಮಂಜುಳ ಭಾಷಿಣಿ ಕುರವಗ ಗಂಧಿನಿ ಕಂಜನಾಭನೆ ಬಾಲೇ ನಾನು ||

    ೩: ಉದಧಿಶಯನ ನೀ ನವನೀತ ಕದ್ದವ ಜಾರ ಚೋರ ನೀನಾರೈ ಕೃಷ್ಣ
    ಕಾಮಿನಿ ಸುಂದರಿ ನೀರಜ ಲೋಚನೆ ಚೋರನಲ್ಲವೆ ಬಾಲೇ ನಾನು ||

    ೪: ಮಂದರಧರನೆ ಪರಿಮಳ ಚೆನ್ನನೆ ಕಂಬುಕಂಧರ ನೀನಾರೈ ಕೃಷ್ಣ
    ಚಂಚಲ ಲೋಚನೆ ಕುಟಿಲ ಕುಂತಳೆ ಕೋಮಲಾಂಗನೆ ಭಾಮೆ ನಾನು ||

    Audio link: https://soundcloud.com/vigneshsublimes/kamala-komala-purandara

    ೫: ಕಮಲಾರಮಣ ಕಲುಶ ನಿವಾರಣ ನಿಷ್ಕಾಭರಣ ನೀನಾರೈ ಕೃಷ್ಣ
    ಕಾಮುಕ ಕಾಮಿನಿ ಚಂಪಕ ಗಂಧಿನಿ ಪುರಂದರ ವಿಠಲನೆ ಬಾಲೇ ನಾನು ||

    Reply

  223. Posted by Lakshman on December 3, 2013 at 4:10 pm

    kamala kOmala. rAgA: saurASTra/tilang. tripuTa tALA.

    1: kamala kOmala karatala lAlita pAda pallava nI dArai krSNa
    kAmini bhAmini rUpada candava nODabandene bhAme nAnu
    2: nanda nandana yadukula vandyana indu vadana nI dArai krSNa
    manjuLa bhASiNi kuravaga gandhini kanjanAbhane bAlE nAnu
    3: udidashayana nI navanIta kaddava jAra cOra nI dArai krSNa
    kAmini sundari nIraja lOcana cOranallave bAlE nAnu
    4: mandaradharane parimaLa cennane kambukandhara nI dArai krSNa
    cancala lOcane kuTila kuntaLe kOmalAngane bhAme nAnu
    5: kamalAramaNa kaluSa nivAraNa niSkAbharaNa nI dArai krSNa
    kAmuka kAmini campaka gandhini purandara viTTalane bAlE nAnu

    Reply

  224. Posted by Raghavendra on December 3, 2013 at 1:31 pm

    Can someone please post the lyrics for “Kamala Komala” composed by Purandara Dasaru? Thanks.

    Reply

  225. Posted by Mahesh kumar on November 18, 2013 at 8:45 pm

    Hi

    i just heard a devotional song in radio for 30 seconds but suddenly they stopped it and im looking for it Please help me (Kannada)

    It started as.

    sri kara karunakara jaya nitya mangalam

    Reply

  226. Dear Meera,
    I hope you are quite relaxed after a nice trip to India after a long time.I hope you enjoyed a lot. Iam looking for lyrics to Sri Sooktham in praise of Godess Lakshmi for a long time. Can you or any of our friends help me? Thanks a lot in advance.

    Reply

  227. Posted by Lakshman on October 29, 2013 at 10:31 am

    Corrections welcome.
    paNDarApuravemba doDDa. rAgA: madhyamAvati. Adi tALA.

    P: paNDarApuravemba doDDa nagarA alli viThObanemba doDDa sAhokArA
    A: viThobaniruvadu naddi tIrA alli paNDari bhajane vyApArA
    C1: beNNime tAyi nInE pANDurangA namma brahma bandhu baLaga nInE pANDurangA
    bhaktara pOSaka pANDurangA namma mukti dAyaka pANDurangA
    2: viThOba nIyE priya tuLasihArA alli bhaktara janara vyApArA
    viThObanige priye buddhigandhA alli candrabhAga prANa balavantA
    3: shrI hari viThalA pANDurangA priya hari viThalA pANDurangA
    viThalA viThalA pANDurangA namma purandara viThalA pANDurangA

    Reply

    • Posted by Bhavana on December 12, 2013 at 7:10 am

      Sir,
      These are the corrected lyrics.

      paMDharApuraveMba doDDa nagara alli viThObaneMba sAhukAra
      viThObaniruvadu naditIra alli paMDharibhajane vyApAra ||pa.||

      taMde nIne tAyi nIne pAMDuraMga namma baMdhu nIne baLaga nIne pAMDuraMga
      bhaktara pOShaka pAMDuraMga namma muktidAyaka pAMDuraMga ||1||

      viThObanige priya tuLasihAra alli bhakta janara vyApAra
      viThObanige priya bukkiya gaMdha alli chaMdrabhAgA snAna balu aMda ||2||

      shrIhari viThThala pAMDuraMga jaya hari viThThala pAMDuraMga
      viThThala viThThala pAMDuraMga namma puraMdara viThThala pAMDuraMga ||3||

      ಪಂಢರಾಪುರವೆಂಬ ದೊಡ್ಡ ನಗರ ಅಲ್ಲಿ ವಿಠೋಬನೆಂಬ ಸಾಹುಕಾರ
      ವಿಠೋಬನಿರುವದು ನದಿತೀರ ಅಲ್ಲಿ ಪಂಢರಿಭಜನೆ ವ್ಯಾಪಾರ ||ಪ.||

      ತಂದೆ ನೀನೆ ತಾಯಿ ನೀನೆ ಪಾಂಡುರಂಗ ನಮ್ಮ ಬಂಧು ನೀನೆ ಬಳಗ ನೀನೆ ಪಾಂಡುರಂಗ
      ಭಕ್ತರ ಪೋಷಕ ಪಾಂಡುರಂಗ ನಮ್ಮ ಮುಕ್ತಿದಾಯಕ ಪಾಂಡುರಂಗ ||೧||

      ವಿಠೋಬನಿಗೆ ಪ್ರಿಯ ತುಳಸಿಹಾರ ಅಲ್ಲಿ ಭಕ್ತ ಜನರ ವ್ಯಾಪಾರ
      ವಿಠೋಬನಿಗೆ ಪ್ರಿಯ ಬುಕ್ಕಿಯ ಗಂಧ ಅಲ್ಲಿ ಚಂದ್ರಭಾಗಾ ಸ್ನಾನ ಬಲು ಅಂದ ||೨||

      ಶ್ರೀಹರಿ ವಿಠ್ಠಲ ಪಾಂಡುರಂಗ ಜಯ ಹರಿ ವಿಠ್ಠಲ ಪಾಂಡುರಂಗ
      ವಿಠ್ಠಲ ವಿಠ್ಠಲ ಪಾಂಡುರಂಗ ನಮ್ಮ ಪುರಂದರ ವಿಠ್ಠಲ ಪಾಂಡುರಂಗ ||೩||

      Reply

  228. Posted by sharada on October 28, 2013 at 9:48 pm

    hi please post lyrics of thaayi sharade from Bettada hoovu movie
    thanks

    Reply

  229. Posted by madivalasrihari on October 28, 2013 at 4:06 am

    how to download kalpavruksha kamadenu daily and inform your cell number for further clarification

    Reply

  230. Posted by suhani on October 25, 2013 at 6:32 am

    hi…..y no blog about Deepavali

    Reply

  231. Hello Meera avare,

    You have doing a yeoman service to all by posting kannada/sanskrit and other langauage Bhakti stotrams/slokas…

    My heartfelt thanks and greetings…

    Sathyanarayan.

    Reply

  232. Posted by Guruprasad B on October 18, 2013 at 8:16 am

    Namaste Madam,
    Here with requesting to please send the below said bhakti geete lyrics either in kannada or english
    1) Hari guna gao anand…
    2) Pandara Puravemba Dodda Saara alli … – Purandaradasaru

    Reply

  233. you have kannada bhajane ” nanna denide hariye yela ninna dagide”
    Please send urgently

    Reply

  234. Posted by prabha sridhar on September 30, 2013 at 9:42 am

    please send me kamadhenu maha mantra lyrics

    Reply

  235. Posted by Nagashree Kiran on September 24, 2013 at 7:37 am

    can you pl send me the Lyrics of” Nee Namma geluvagi baa gajamukhane”

    Reply

  236. Posted by Bhavana on September 15, 2013 at 9:38 am

    Dear Sushma,
    The Soundarya lahari is available here both in kannada and Sanskrit scripts.
    https://sites.google.com/site/ysysmath/
    – Bhavana.

    Reply

  237. Posted by Sushma on September 13, 2013 at 11:45 am

    Can you please upload the song of DEVI MANASA POOJA, SOUNDARYA LAHARI.

    Reply

  238. Posted by Sushma on September 13, 2013 at 11:43 am

    Thank you madam for these lyrics of all traditional songs and audio ….My grand mother was happy seeing all these things…

    Thank You

    Reply

  239. Posted by Lakshman on September 5, 2013 at 9:28 pm

    You can figure out the words from here:

    Reply

  240. Posted by Lakshman on September 5, 2013 at 5:21 pm

    guruvAra banthamma gururAyara neneyamma
    guruvAra banthamma gururAyara neneyamma
    smaraNe mathradali klesha kaLedu sadgatiya koDuvanamma

    vAra banthamma guruvAra banthamma
    rAyara neneyamma gururAyara neneyamma

    yOgi baruvanamma shubha yOga baruvudamma
    rAghavEndra gururAya bandu bhava rOga kaLevanamma
    vAra banthamma guruvAra banthamma
    rAyara neneyamma gururAyara neneyamma

    manava toLeyiramma bhakthiya maneya hAkiramma
    dhayna dinda karedAga bandu olaganna berevanamma
    vAra banthamma guruvAra banthamma
    rAyara neneyamma gururAyara neneyamma

    kOpa ariyanamma yAranu doora tallanamma
    prIti mAthige sothu baruva maguvanthe kANiramma
    vAra banthamma guruvAra banthamma
    rAyara neneyamma gururAyara neneyamma

    hinde baruvanamma rAyara neralinanthe hanuma
    hanumaniddhede rAmaniddu nija mukti koDuvanamma
    vAra banthamma guruvAra banthamma
    rAyara neneyamma gururAyara neneyamma
    smaraNe mAtradali klesha kaLedu sadgatiya koDuvanamma

    Reply

  241. Posted by Lakshman on September 2, 2013 at 10:13 am

    Is this the song?

    hiDagO biDabEDa. rAgA: pUrvikalyANi. Adi tALA.

    P: hiDagO biDabEDa rangana pAda
    A: hiDgO biDabEDa keDuka kALingana maDuvinoL dhumuki kuNidADo krSnana pAda
    C1: puTTidAgale iva durjananenutali attidarAgale tAi tandeyaru muTTi
    tanage molegoTTaLa maDuhida duSTa krSNana hOga biTTare sikkanu
    2: ochottannake naDedare baNDiya nuccu mADi cakalali odda
    shikSisalu jODu vrkSava taridiTTa raccegAranendu beccade jagadoLu
    3: iddalli iraniva buddhi eLLaSTilla hiddanEri tirugADuvanu
    medde yAtake maNNa tEge bAyanendare adyanta jagavanu tOri anjisidana
    4: makkaLoLalge puNDa mane manegaLa hokku sakkare norehAru savisavidu
    bekkina mEliTTu beNNeya tA meddu sikkade jigidODi pOguva kaLLana
    5: sAra hrdayanalla bhAriya guNavilla Ara mAtanu iva lekkisanu
    nIroLagiLidu nArEra sIreya kaddu hAri honneya maravErida krSNana
    6: kALa rakkasaroLu kadana bEDendare hELida hAge kELuvanalla
    kUDe Aduva makkaLanji koNDarAga kALiya muridiTTa kaiyALi rangana
    7: jIrige bellava hiDidambikeyanu sAri banda rukmiyanu kondu
    hOra bEDendare rukmana heDagayya tErige bigidanda cOra krSNana pAda
    8: aTTi hAyuva Elu kULigaLannu kaTTi strAjitake ratnavittu
    aSTa mahiSiyara artiya salisida shrSTi koDeya shrI krSNana pAdava
    9: iruLoLu hengaLa kUDi Adutali vara yamuneya tIradi ninta
    barimADil hadinAru sAvira taraLEra maruLu mADida madana gOpAlana
    10: khakkane mathurege pOgi baruvenendu akkayya gOpige pELutalidda
    khakkaLe balarAmanoDa kUDi rathavEri sikkade hOguva akrUra varadana
    11: Aneya maDuhida agasana keDahida tAnarasage tanda huvane muDida
    mAnini kubugolidu kandha dharisida gAnavinOdi shrI lakumiya arasana
    12: mallaranellara cellADi keDahida billu muridu mAvana maDuhi
    nillade dEvaki sereyanu piDisida pullalOcana shrI krSNana pAdava
    13: narakurigaLanella bharadi rakSipudakke parama pAvana nAma idu sAlade
    kali dhruva bali pAncAlige varavitta purandara viTTalana caraNa kamalavanu

    Reply

  242. Posted by deepika on September 2, 2013 at 5:49 am

    dear meera,

    kindly send me the kannada lyrics for “ABHIRAMI ANDHADHI” the original is in tamil have been searching a lot for the kannada version please send it to deepikad.nov23@gmail.com

    Reply

  243. Posted by Suneetha R Bhandarkar on September 2, 2013 at 1:56 am

    hidako bida raghavendra pada lyrics is wanted please

    Reply

  244. Posted by Lakshman on August 31, 2013 at 10:07 am

    allide summane illi hOde. rAgA. pUrvi / durgA. aTa tALA.

    P: allide summane illi hOde summane
    C1: katha bAgilirisiha kaLLa mane idu mudadinda lOlADO suLLu mane
    idarAgi vaikuNTha vAsa mADuvantha padumanAbhana divya baduku mane
    2: mAlige maneyendu necci keDalu bEDa kELayya harikathe shravaNangaLa
    nALema dUtaru bandeLedoivAga mALige mane sankaTa bAradayya
    3: maDadi makkaLembo hambala ninagyAtakO kaDugobbu tanadali naDeyadiru
    oDeya shrI purandara viTTalana caraNava drDha bhaktiyali nI bhajiselo manuja

    Reply

  245. Dear Meera;
    Do you have the lyrics of the song ” Allide namma mane Illi bande summane”? I think it is a composition of Purandhara Dasaru. Thanks a lot if you give me.

    Reply

  246. Dear Lakhman

    can u send the songs lyrics in kannada language [Mahadeshwara daya barade]

    Reply

  247. do you have kannada bhakti songs in kannada lyrics
    mahadeshwara daya barade neenillade nanage badukellideyee

    Reply

  248. do you have kannada dasa bhakti song in kannada lyrics
    anu dhina ninna nenedu bhakti songs

    Reply

  249. Posted by Soumya on August 20, 2013 at 1:31 am

    hello meera avare.. pls share with me the lyrics of Indu shukravaara, shubava taruva vaara.. if you have it..

    Reply

  250. […] have added several lyrics on Shri Raghavendra Swamy in this blog, you can look for those at the lyrics page, or click on the Shri Raghavendra Swamy categories section and you will be listed with several […]

    Reply

  251. Posted by shrisha on August 10, 2013 at 10:46 am

    Hi Meeraji,
    Any idea, where can i get Sampat shukravarada hadugalu (popularly known as saayakka and Dheyakka’s song)kannada version of songs.

    Reply

  252. Posted by Soumya on August 8, 2013 at 4:09 am

    Hi Meera avare , nim blog na naanu eevate nodidu, tumba chanagi ide…. naanu sanna makalige shloka haagu hadugalanna helkodtini.. nange kelavu shlokagala kannada version bekithu. help madi pls.
    Vakrathunda Mahaakaaya Suryakoti Samaprabha Nirvignam kurumey deva Sarvakaryeshu Sarvada
    Vasudeva Sutham Devam Kamsa Chanoora Mardhanam Devaki Paramanandham Krishnam Vande Jagathgurum.
    Agajaanana Padmaarkam Gajaananam Aharnisham Anekadantham Bhaktaanaam Ekadantam Upaasmahey
    Gajaananam Bootha Ganaathi Sayvitham Kapitha Jumbu Phala saara Bakshitham Umaa Sutham Shoka Vinaasha Kaaranam Namaami Vigneshwara Paadha Pankajam
    Shuklam-bharadharam Vishnum shashivarnam chaturbhujam | Prasanna vadanam dhyayet sarva vighnopa-shantaye ||

    Reply

  253. Posted by Lakshman on July 30, 2013 at 3:42 pm

    If you know Kannada you can listen to the song here and figure out the lyrics. Then you can post them on the site. Thanks.

    http://www.dhingana.com/dasanagabeku-song-dharmasthala-sri-manjunatha-kannada-220e5b1

    Reply

  254. Posted by sujaya on July 30, 2013 at 2:27 pm

    Hi,
    I am looking for the lyrics for Dasanaga Beku Kanadasa Pada but am unable to find the lyrics. Kindly help.

    Reply

  255. […] have added several lyrics on Shri Raghavendra Swamy in this blog, you can look for those at the lyrics page, or click on the Shri Raghavendra Swamy categories section and you will be listed with several […]

    Reply

  256. Posted by Shwetha Sudheendra on July 25, 2013 at 12:02 am

    Hi all…..

    can someone help me wid “srinatha govinda aananda mooruthige” lyrics please…

    Reply

  257. do you have kannada dasa bhakti song in kannada
    NANNADENIDE HARIYE AALA NINNADAGIDE

    Reply

  258. Posted by Nirmala Rao on July 3, 2013 at 3:33 am

    Thank you both so much for posting the lyrics of the two songs that I requested.
    Kind regards
    Nirmala

    Reply

  259. Posted by Lakshman on July 2, 2013 at 11:11 am

    The audio for jANA nenahudO is available here. Perhaps someone knowledgeable in kannaDa can post the lyrics in English. Thanks.

    http://mio.to/#/search/clips/global!q=jaana+neenahudo

    Reply

  260. Posted by Lakshman on July 1, 2013 at 7:22 pm

    shrI rAma ninna. rAgA: nATakuranji. Adi tALA. Shripadaraya.

    P: shrI rAma ninna pAdava tOrO mOhana guNadhAma ninna mOhada pAdava
    A: varaguNajAla suraguNalOla karuNAlavAla taruNiya paripAla
    C: ajavara pUjita gajavara bhAvita sujanara carita trijaga vandita
    (madhyamakAla)
    angaja caraNa shashi ranga turanga tunga tirthamalika rangaviThala
    (another version)
    angaja pramukha plavanga turanga tunga vikrama shrI rangaviThala

    Reply

  261. Posted by Sujatha Rajagopal on June 30, 2013 at 9:11 am

    hello meera mam, pls I want song lyrics of this three songs in english
    1.
    loka bharithano
    2. ishtu dina e vaikunda
    3. manasu karagathae swami dhayavu bharate

    I have searched in all the web sites, but I couldn’t get, pls help me
    my mail id succhi86@gmail.com

    Reply

    • Posted by meeraghu on June 30, 2013 at 9:36 am

      Sujatha,
      Just posted ishtu dina e vaikunda lyrics in English. As time permits, will post others as well.

      Reply

      • Posted by sujatharajagopal on July 2, 2013 at 5:03 am

        Meera mam,
        Thank you so much for your kind help. Really am very proud of your service.
        Waiting for the other songs translation
        Once again thank you

  262. Posted by Nirmala Rao on June 27, 2013 at 9:38 pm

    Namasthe Meera ….can you please post the lyrics of these two songs…kannada or english

    a) jaaNa neen ahudo guru mukhya prana neen ahudo – Vyasaraja theertharu
    d) sri rama ninna paadava thoro – Padaraja theertharu

    Many thanks
    Nirmala

    Reply

  263. do you have kannada bhakti song in kannada: NOMO BHUTANATA satya harichandra picture

    Reply

  264. do you have kannada bhakti song in kannada: Thappu Nodade bandeya, Ennayya thande

    Reply

  265. do you have Kannada songs beda krishna ranginata seere neneude
    in kannada lyrics

    Reply

  266. Haraye Namah,

    I do have Guruguna Stavana Lyrics with meaning in English…uploading here the same…sooon i’ll get kannada version will upload.

    GURUGUNA STAVANA (in English with meaning)

    1st shloka:
    unmeelanneelaneeroruha nivahamahah pushtimushtindhayisrih
    sri bhoodurgaadrubantaprachaya parichayo daarakirmeera bhaavaha |
    svairaksheerodaniryacchashiruchinichayaasvargarvopanodi
    paathu sriineturasmaan sapadibuda janatraana dakshah kataakshaha ||
    The enchanting beauty of the cluster of the just blossomed dark blue lotuses that too viewing it continuously like drinking water from a jar without discontinuity is negated by a side glance of the exquisite side glance of Sri Bhoo Durga (Goddess Lakshmi) and this special colour of just her glance also obliterates the arrogance of the sheen of the moon which has risen from the milky ocean. This beautiful glance reaches the eyes of the Lord Pundarikaaksha and enhances it whose power is capable of protecting the suras (devas) and bhoosuras (virtuous men) may also protect us with the utmost promptitude.
    The above shloka is as usual the bendictory verse to Lakshmi Narayana but the alankaras and the metre involved is really incomparable. We are reminded of the seventh chapter of the Dwadasha stotra where similar opinions are voiced by Srimadaacharyaru. (Sriyat kattaaksha balavatyajitham namami…) In this poem we find the unique Prateepa alankara where the Upamana (Lakshmi) is given prominence when compared to the Upameyam (Moon, Lotus, etc.).
    Also, the author does not merely stop to say that the loving glance of the Lord (as said in the Dadi Vamana Stotra – Chandrakoti Susheetalam) protect the Devas and the Bhoosuras (virtuous) people but also without wasting any time protect us also. This is called Parikara alankaara.The above passage has one more meaning that we may also be elevated to the level of at least the Bhoosuras by the benign grace of Sri Harih.
    2nd Sloka:
    maathashtvaaamupakalpitaakhila jagatjsargejagabhargedite
    chetenaprajahaatu jaatuchititaha svargepavargepinah |
    laavanyaadadhareekritaamaravadhoovargenisargehitam
    kaarunyamkurumaakritaamayi punardurgevisargematim ||
    The second shloka also eulogises Sri and in this one shloka also highlights the greatness of Her qualities as Goddess Durga also by the saint. Oh! Godess Lakshmi you are Lakshmi and Durga , the mother of this whole Universe and you are the creater of Brahmaadi Devaas (under the aegis of Lord Narayana) and your extraordinary effulgence nullifies the beauty of the divine group of women. Wherever we are, in this earth or in heaven please ensure that we do not live a life of oblivion about you and be kind enough to grant our deserving wishes (according to the svaroopa of the soul) and when we are in poverty (materialistic and spiritual) kindly do not foresake us. In short let us be blessed to be thinking about your feet always.Here in this shloka Sri Vadindraru has effectively made use of the Adisayokti alankara (which stimulates us to wonder).
    3rd sloka:

    Srimadraamaabhiraamaamita mahima padaprouda paathoruhaalih |
    krishnaanishtaamitakshma parivrudapatalee paatanaika praveenahah ||
    vedavyaasopadeshaadhika samadhigataananata vedaanta bhaavo |
    bhooyaat keechaavaneeshaa vratitanuranilah sreyase bhooyase nahah || -3-
    The saint poet Sri Vadindra Teertharu then renders a mangala shloka in the praise of the three avataras of Sri Mukhyapraanaa. May Mukhyapraanaa who is very dear to the Lord is hovering like a bee in the vicinity of the lovely lotus feet of Sri Ramachandra, in the incarnation of Sri Bheemasena had the wonderful capacity of destroying single handedly innumerable emperors (Jarasanda, Duryodana and the like) who were enemies of Sri Krishna (both Sri Yadava Krishna and also to Draupadi who is also called by that name) and in the last avataara as Sri Madhaachaaryaru learnt the purport of the Vedas, Upanishads and other shastras under the feet of Sri Vedavyaasaa and rendered the meaning of the same in the form of the Brahma Sutra Bhasya, bless us
    bountifully with all the Purushaarthaas including Moksha saamraajyaa.
    In this shloka the poet refers Vaayu Jeevothama as a bee because the bee is not satisfied by drawing out nectar from one particular flower and goes on sucking honey from various flowers so also the Haribhaktas and Daasaaas are not exhausted by the nectarine delight of the names of the Lord and endlessly drink the elixir of various divine names. The verse starts with “sri mad raamaabiraamaa” which is a case of “vritta anupraasa alankaraa” as the name of raama is used twice for the purpose of getting the correct metre.(similar to that of rain rain go away, twinkle twinkle little start etc.). “tadroopaa ubhaya roopaaalankaaraa” is used when Sri Hanumantha is described as a bee at the feet of Sri Ramachandra prabhu.
    4th shloka
    Udvela vyaasata tantra vyasavsitanikhilaabhijnahradyaanavidya
    nantatrayyantabhaava prakanaghatanaa sarvatantre svatantre/
    samvarnye mantravarnairanitaravishayasparshibhih paavamaane
    roopelokaikadeepe prasaratuhyadayam maamakam madhvanaamni//
    The saint is not contended with bowing to mukhyapraana in the previous shloka continues to pray the foremost preceptor of madhva tradition sri madhvacharya with great reverence in this shloka.
    Let my mind and heart reach and hover around the third avataara of Sri Mukhya praanaa who had grasped all the prameyaas flawlessly and also the upanishad vaakyaas and works of Sri Vedavyasa with special reference to the Brahma Sutras, who always stressed upon the greatness of Sri Vedavyaasa alone,whom the vedas (Balittha suktha etc) glory and one who increases the gnaana in the intellect of the saativika souls. (In the shloka, paavamaane means one who purifies ). The verse is again in the sraghdara metre and the poet uses vrittaanupraasa alankaara while using the words sarvatantre,svatantre,samvarnye,etc.(alliteration).
    5th shloka
    vijyaanodarkatarka gratipadamdhurodaarasandarbhagarbha
    proudaanekaprabandha prakatitha bhagavathpaadabhaashaadi bhaava/
    mithyaavaadaapavaada prakupitavimatadhvaantasantaapabhaanu
    jeeyaadanyairajayyah tribhuvanaviditaascharyacharyo jayaaryah//
    In this shloka teekachaaryaru is propitiated by the poet. May Shri Teekaachaaryaru who is honoured for Nyaya Sudha and other wonderful works which are of excellent verses and captivate the minds of the scholars and bereft of unwanted jargon is replete with logic which contains the essence of the Sutra Bhaashyaa of Srimadaachaaryaru and the sarva moola and personification of jnaanaa and bhakthi ,who is like bhaanu(resplendent sun) which removes the rows of darkness in the form of mithyajnaanaa and the like and the saint who is unconquerable and famous in all the three worlds, stand none to excel.
    Sri Vyasaraaja tirtha has composed a song on Sri Jayatirtha on similar lines as follows:
    Amita divjaavali kumudangalarisi vimatara mukha kamangala vaadisi………
    Aarthi mandaara vedantha vichaaraa, samastha Sri Krishna Padaambuja lola.
    The words vimata dvaanta santaapa bhaanu is a example of roopakaalankaaraa. Vaadopavvada,ascharyacharyo are examples of vritti anupraasa alankaaraa.
    Shloka 6
    Srimatpoornaprabodhaprakatithapadaveedhavibhedhaavidheemat
    Senaabaaseeraseemaa samudithaviditaabaadayodhaadi netha |
    maayaasiddhaanta deekshaavighatanaghatana sarvatantra svatantrah
    sriraamavyaasadaaso vilasati vibhudeendraabhidah samyameendrah ||
    The poet next eulogises the 11th pontiff of matha, Sri Vibhudendra tirtha. Let Sri Vibhudendratirtha, the ardent disciple of the brilliant srimadaachaaryaru and the foremost of the unbeatable warriors of the batallion of the gods and pandits, who can establish the dvaita vedanta without help from anyone and defeat the maayaavaadins and who continuously worships Sri Veda Vyaasaru and Sri MoolaRaamachandramurthi, shine effulgently.
    In this poem it is highlighted that Sri Madhvacharya and Vibhudendra tirtha both have in common the svabhava or nature of silencing others and hence is a classic example of Svabhavokti Arthaalankaaraa. By using the word vighatanaghatana the poet has used the chekaanupraasaa alankaara. Sarvatantra svatantre is vritti anupraasa alankaaraa.

    Sloka 7
    Maayaatantraamararismayamapanayato madhvasiddhaantanaamno
    netraaneevatrayopithrijagathi nrharerindhate yatprabandhaah |
    Yadvagadvaithavidytaachalakulishapraudimaadaukate sah
    sreyobhooyo vidadhyaatsumahitamhimaasamprati vyaasaraajah || 7
    Meaning:
    A prayer is now addressed to the great Vyaasaraaja Gurusaarvabhauma.
    May Sri Vyasaraja who is famous for his ratnatraya (Taatparya Chandrika, Nyaayaamrita and Tarkataandava) which resemble the three glowing eyes of Sri Narahari in the garb of Dvaita Siddhanta in obliterating the arrogance of Hiranyakashipu the foe of the gods who declared himself as god, as a Vajraayudhaa or the thunderbolt of Indra which could smother the Advaitic mountains, take compassion on me and bless me here and hereafter.
    In this verse the upameyam is the three works of Vyasaraja tirtha and the upamanam is the three eyes of Sri Narasimha. Since the upameyam does also the work of upamanam it is a case of Ubhaya saadaarana dharma. Though the upameyam and upamanam are similar in action but are different entities it is a case of Poorna upamam which leads to Arthaalankaaraa.
    Netrena trayopi is a case of Anupraasaa alankaaraa.
    Shloka 8
    Chaaturyairkaakrutiryaschaturadhikashatagrantharatnapraetha
    dhootaaraati prabandah sfutaviditachatuh shashti vidyaavisheshah |
    soyam nah srisurendravrativaratanayodvaitashaivaasahishnoh
    pushnaatu sri jayeendraadrastribhuvanaviditah saratantrasvatantrah || 8
    Meaning:
    The poet proceeds to offer obeisances to the Chatushashtih Kalaa Purna, Sri Vijayeendraru. Sri Vijayeendra tirtha who has to his credit one hundred and four wonderful books which are effective in opposing other shastras and establishing Tatvavada, who is a master of the sixty four arts like music, crafts, dance, idol making and the like, who staunchly opposed the Saiva and Advaita religions, who suceeded to the pontificate after Sri Surendra tirtha, who is a sarva tantra svatanra (do not need external help to know other sidhantaas) and famous in the three worlds, may be pleased to take care of us.
    It is said that the Saint used to carve within half an hour a Udupi Krishna idol and present it to some lucky devotee. The Saint had written 104 works superseding Appayya Diskhitar who had written 103 works. Here the ashrama guru of the Saint, Sri Surendra tirtha who was known for his penance and Bhoo pradakshina is very much honoured.
    The verse is decorated by Roopalankaara while describing the Chaaturyaa of Sri Vijayeendra tirtha and the metre is Sraghdara metre.
    Shloka 9
    vyaadutavadya hrudtaamitha kruthi rachanacharu chaaturya hrushyat
    karnatakshonipaala pratipadarachita aneka ratnabhishekaha |
    patrisharooda lakshmipathi padanalinodh agrolamba leelo
    vikhyatah srisudheendra vratipatiratulam bhadram unnidhrayen naha || 9
    Meaning:
    Sri Sudheendra Teertharu who is the personification of fame and story and also has the blessed capacity of being the another of blemishless and wonderful granthas like “sahityasamrajya” and the like had been honoured by the king (many kings) of Karnataka by the performance of Ratnabhisheka (showering of priceless gems) not once but in several occasions. The hallowed saint is compared to a bee that hovers around the feet of “Patrisharooda” (the Lord and his Consort on top of Garuda). Sri Vadeendra prays that such a holy saint may be kind enough to bless us with all auspicious merits.
    Vishesha Artha:
    The saint was well versed in the shaddarshana (Sankhya, Yoga, Nyaya, Vaiseshika, Purvamimaamsaa and Uttaramimaamsa) and hence called as Shaddarshanacharya. Since he was the recipient of various gifts and titles from a plethora of kings he was also addressed as Rajamanya. The poet says that His Holiness had composed Sahitya Samrajya and other works. Some of them are Sadyulesi Ratnavali (on Tarka tandava of Vyasaraja Teertha), Sutra Pradipa (on mimamsa). 2 books on Alankara (Alankara manjari and Nikhasa) and a nataka called Subadra parinaya and Dayalu Shatakam (a stotra). The saint had also written a lucid commentary on the Bhagavata Purana (2nd and 11th skanda). The Gwalior Maharaja, Raghunatha Bhoopala Nayaka of Tanjavur and the Vijayanagara Samrat has accepted His Holiness as their Rajaguru. and the former had conffered the title “Digvijaya Simhasanaadeeswara”.
    Apart from writing many works His Holiness used to do elaborate puja to the holy dieties and idols of the matha and the Visraha used for His upasana (Garuda vahana Paramaathma) can still be seen adorning the residue of idols of Rayara matha. Last but not the very least His Holiness cannot be afforded to be forgotten because he was the most fortunate and blessed saint to have ordained Mantralaya Mahaprabhu Gurusarvabhouma Sri Raghavendra Teertha into sainthood and gave the whole world the Kaliyuga Kalpataru.

    Shloka 10
    dhutavadyairavidyavighatanapatubhirvidvadabhyarthaniyai-
    rvacah pracam pravacamupacayamabhajan yatkrtajranthajalaih sankhyavanto yamahurmuhurakilakalamurtimudvelakirti-
    rdhira SriRaghavendrah sa disatu satatam bhavyamavyahatam nah ||10
    Namaskara to one who has written works to remove ignorance, and that which has been revered by many scholars, one who has highlighted the great works of predecessors and who is glorified by many people – none other than the great Sri Raghavendra teertharu. The saint prays His Holiness to shower his anugraha.
    Shloka 11
    ye ramavyasapadapranihitamanaso madhvatantrapratista-
    dhuryamaryadasamvitsumahitasumatindraryasisyagranyah |
    nityatrayyantacintaparinatavisadasesatattvavabodha-
    prakhyatan tanupendravrativibudhamanin desikanasraye’ham || 11
    Here the greatness of the ashrama guru of Sri Rayaru Sri Upendra teetaru is described as one who always meditates on Sri Raama and Vedavysa and also one of the famous disciples of Sri Sumateendra swami and also One who is always contemplating on shastras and also praised by saadhoo janas. Namaskara to such a great saint.
    Shloka 12
    yogo yah karmanama kavibhirabhihito yasca vijnanasanjnah
    sakto nasiddhakayastanumatiranayostavadavarjane’ham |
    yascopayairupeyah sthiraphalavidhaye desikasyaprasada-
    stasmai tasya stuviyanisamapi caritam raghavendravratindoh || 12
    In this shloka in all humility the great saint feels that it is impossible to try to reach the Lotus feet of the Lord by both jnana marga and karma marga,since this body is ephemeral and the saint feels that one can only be saved by Sri Raghavendra Swamiji’s benign grace which in turn is only possible if we constantly cherish the greatness and compositions of Sri Rayaru.
    Shloka 13
    esa sriraghavendravrativaracaritam bhonidhih kkativelah |
    kkasau khadyotapotapramusitavibhavascetaso nah prakasah |
    vandhyaivatah pratijna tadatulanikhilascaryacaryabhidhane
    sthane thapi kkacit syadiha punarudadhisnanasa lpavat syat ||13

    Sri Vadeendra Theertha admits though he is not able to fully exhaust the greatness of Rayaru, he has just attempted to bring out the same in the sloka.
    It exhibits the great humility of His Holiness. Just like one gets contended of having taken bath in the sea by doing so in the corner of its shore. So also Shri Vadeendra Theertha feels that even highlighting few of the glories of Shree Rayaru. It is felt that Sri rayaru has been glorified. Indeed is it possible to fully exhaust the greatness of His Holiness.
    Shloka 14
    yadbhanau yatkrsanau yadamrtakirane yad grahesuditesu
    jyotiryattarakasu prathitamanisu yadyacca saudaminisu |
    sambhuyaitat samastam tvadamitahradayakasaniryatprakase
    dhira sriraghavendravrativarabhajate hanta khadyotaritim ||14
    The poet continues to praise the greatness of the compassiante saint in this verse also as under:

    “The scorching brilliance of the sun,the scathing heat of fire. the cool and pleasant light of the moon, the scintillating radiance of all the stars put togther and the rays emanating from all the gems are put together will produce a light that will only be like a firefly before the sun of mellifous radiance emanating from the heart of Sri Rayaru which hosts the Lord.The poetic imagination of the author reaches the zenith in this verse and adds a tinge of flavour to the kavya.
    cittenayuktamartham kalayati sahasa nabhidhatte na sadbhih
    sakam mimamsate va na likhati vacasodghatayatyasayam svam |
    uktam no vakti bhuyah kvacidapi likhitam naiva nirmarsti tasma
    dasmabhih satprabandhapranayanavisaye stuyate raghavendrah || 15
    Here the greatness of the works of Sri Rayaru is brought to limelight. Guru Sri Raghavendra swamin- Your Highness always think about correct knowledge,never mention anything that has not been uttered by jnanins there is absolutely no redundance in any of your works which implies every time a new theme is highlighted never erase what has already been written so it is imperative that all glorify your great works.
    dhirasriraghavendram krtanijavijayasragdhararthaprakasam
    drstva santhustacetah dasamatiraciradabhyasincatpade sve |
    nunam vani tadiyananalinagata tatkrtasvapriyaika
    pratyasangaprahrsta svayamapi tadanu sve pade cabhyasincat || 16
    In this shloka the reference of the gloss on the prameya navamaalika (which comprises of 32shlokas) is mentioned. Mantralaya swamin – In your poorvaashrama your holiness authored a gloss on the prameya navamallika and since it dealt with elaborately on the greatness of Mukyaprana and his glories deeds ,his consort Sri Bharati devi decided to install Venkatanatha on the vedanta samrajya.
    This wonderful work known as gooda bhaava prakaashika helps scholars to understand the original work .
    grantho vadavali dragabhajata vidito durmataranyadahat
    apurvardhapratipakramaparipathitasvabhidhagocaratvam |
    tasya sriraghavendravrativara bhavato vayuvamsaprasute
    retarhyuddhipanam yattaducitamitti me manasi vrttirindhe || 17
    Sri Teekaakritpaadaru(Sri Jayatheertharu) had written a work called vaadavaali to help to remove the ignorance and the gloss by Sri Rayaru highlighted it more.If the first two letters of vadavali are interchanged it becomes daavaavali or forest fire which destroys ignorance . Indeed this work of Your Holiness is burning brightly in my heart always like the brilliance of a forest fire- thus opined Sri Vadeendra Theertha sripadaru.
    vandarupranicetah sritatimiraparibhavakausalyabhajh
    tejaste raghavendra vrativara kimiti srimato varnayamah |
    yenaisa candrika pi tribhuvanavisada satpathodancitasrih
    lebhe sarvajnamauliprakatitavibhava tvatta eva prakasam || 18
    This shloka highlights the greatness of Prakasha(tippani of Sri Rayaru on the work Tatparya Chandrika of Sri Vyasrajaru).Can there be any doubt that the Prakasha(light) of Chandrika(moonlight) will dispel the darkness of ignorance of devotees. Sri Raghavendra Guru Sarvabhauma ! The moon which is flawless spreads its light all over the world so also Chandrika Prakaasha too gives light of knowledge to saadhu jana samuha.

    dhirasriraghavendra tvadatularasanaranganrtyatsvayambhu-
    yosa-dhammillabharaslathakusumatatistvagdirah sangiramah |
    yabhih sammisritabhirniravadhivasudha visruta sasudha pi
    ksonigirvanagamyam parimalamatulam sampratam samprapede || 19
    Sri Rayaru is also hailed as Parimalacharya as His holiness had written a work on the famous Sri Man Nyaaya Sudhaa of Sri Teeka krit padaru. It is believed that in His poorvashrama Venkatanatha used to sit in the late hours writing this memorable work and once Sri Suddendra Teertaru himself saw the young boy lying down after writing for that day and His Holiness was much impressed and conferred the title of Parimalacharya’ on him since it gave an exotic fragrance to the intellect.
    Sri Vadindraru here in all poetical excellence compares the tongue of Sri Rayaru as a stage and Sri Saraswati devi joyfully dances on it and the flowers strewn on it from here are the words by which this fragrant work has been done. Is it not natural that it should be hailed as Sri Sudhaa Parimala.
    prayah praganyadiyatanutaravivrti granthavasovihina
    hrina nadarsi dhirairapi kila yuvatirbhasyatikabhidhana |
    adya sriraghavendravratikrtavivrtipraudhakauseyaratnam
    svehayuktam vasana viharati sudhiyamagratah svairiniva || 20
    In this shloka Sri Vadeendraru compares the wonderful work Tatva Prakashika as a young maiden who rarely ventured out due to paucity of a good dress in the form of a gloss. Sri Raghavendra Swami allieviated the concerns of the pandits by writng a remarkable work Bhaavadeepa on tatva prakashika and it is needless to say that the maiden sported with new suitable dress .

    grantho’yam nyayamuktavaliriti bhavata raghavendra pranito
    nunam muktavaliryat prathamamupacitaduddhrtastantrasindhoh | protasca jnanatantau tadanu tava gunapraudhimasamsatam nah kanthesu premabhumna bahumatividhaye va dhuna sannyadhayi || 21
    The divers dive deep into the sea and with great effort take the pearls. These in turn are made as a beautiful necklace and presented to deserving people. Simlarly, from the sea of siddanta,the pearls called adhikaranas have been taken by Your Holiness and woven into a garland(using theintellect of your Holiness as the sacred thread) called the wonderful work called Nyaya muktavali and presented to the pandits with your blessings. Is it not the greatest khanta bhooshana to them.
    hantananto’ nubhasye vilasati bhagavatpadasamvarnito’rthah
    satyam pratyetu lokah kathamidamadhuna tasya tikam vina te |
    dhira sriraghavendra vrativara nivasadvisvamasyantarale
    stoke tokasya saureratibhrsakupitam tatprasumantareva || 22
    In this shloka the saint eulogises the greatness of tattva manjari a unique gloss by Sri Rayaru on the anubhasya of Sri Madhwacharya. It comprises of 32 verses in four chapters which encompasses the meaning of the brahma sutras and also tradition avers that acharyaru composed it to enable Achyuta preksharu to do parayana on sadana dwadashis when entire recitation of brahma sutra bhasya was difficult.
    Sri Vadindraru beautifully alludes this with the incident of Lord Sri Krishna showing the entire universe to mother Yashoda in his small mouth. Sri Rayaru in tattwa manjari has clearly brought out the fact that the meaning of the entire bramha sutra is embedded in the anubhashya. Obeisaance to the great Rayaru who has composed such a wonderful work.

    bhinnairarthairanekaprakaranabhanitairadya madhvagamabdhau
    matya bhuyo vicintya srutiparinataya sastaya sangrhitaih |
    sutresvekaikaso pi vrativara bhavata yojitesu pravacam
    modo yavanna taddak tava punaritarai raghavendra prabandhaih || 23

    Sri Raghavendra Gurusarvabhauma.
    Your Holiness have showered great mercy on your devoteesby diving again and again in the ocean of madhva sastra and brought out various meanings for the sutras ofBadarayana in the great work called TANTRADEEPIKA. The learned scholars are exhilerated overthis great blessing by Your Holiness. This indeed servesas a beacon light for the learners of Brahma Sutras.

    dhira sriraghavendravrativara sujananugrahavyagracitai-
    racaryaih sangrhitah katicana manavah sarabhutah srutibhyah |
    tanevoddhrtya bhuyah sruitsu nidadhata sisyavargopaklaptyai
    loke sadhu vyadhayi srutaguna bhavata” caryanuvrttih || 24

    Sri Madhwacharaya had presented to the devotees a collection of many mantras in the composition called Tantra saara sangraha.Jagadguru Sri Madwacharya while explaining the efficacy of this grantha says,
    “Grantoyam paata maatrena sakalaabheesta siddhitah”.The recitation of this grantha itself is sufficient to get all our desires fulfilled then what could be said if it is attempted to understand it.

    gitamatyarthadhutasritajanaduritaminduvamsaprasutau
    vyacaksane muradvisyabhijanamabhajad bhadramindoranidram |
    dhira sriRaghavendra tvayi punaranaghe hamsavamsodite tam
    vyakurvatyadya bhavyam kathamiva na bhajedasu mitranvavyah || 25
    This shloka highlights the greatness of the excellent work on the Bhagawat Geetha by Sri Rayaru popularly known as ’Geetha Vivritthi’. The chandra vamsha was exhilerated because of the Lord telling the song celestial to Arjuna (which destroys the sins of those who read the same) and while Sri Raghavendra Gurusaarvabhaumaru wrote vivrithi the hamsa vamsa felt honoured similarly (Hamsa in one context means sanyasis in another aspect can be taken as soorya and hence soorya vamsha also felt glad).

    na syadisaprasado guruvarakarunamantareneti rudho
    dhira sriraghavendravrativara suddadhascetasaste vipakah |
    yenavyakhyaya gitamapi gurucaranodaratadhasyatika-
    vyakya vikhyatavidvanmaniganavinuta’kari bhuyastvayaiva ||26

    Munisreshta Sri Raghavendra sarvabhauma out of great respect towards guru Teeka kridpaadaru and of sheer mercy on the scholars your holiness decided to write a commentary on the Pramey deepika (tippani on the geetha bhasya of Jagadguru Sri Madhvacharyaru).

    This great work also brought to light that without guru’s grace Lord’s grace is not possible.Guruvina gulaamanaaguvatanakaa… has to be remembered over here.

    nanatantraprasangatribhuvanaviditodarasarasvato pi
    pratnanekaprabandhapravacanaracanvittatatatkausalo pi |
    sasvad vyakhyatagitakrtirapi vibudhanugrahaikagracitto
    gitatatparyatikavivaranamakarodadbhutam raghavendrah ||27

    Meaning:
    In this verse the greatness of the gloss on Nyaaya deepika (a commentary on the teeka of the geetha taatparya of Srimadaacharyaru by Sri Teekakridpaadaru) is brought to limelight by Sri Vadindraru.

    The saint opines that the work was composed by Sri Rayaru purely out of his benign attitutde towards the scholars .

    laksminarayanaryastava tanayamanih satsu sarvesu dhanyo
    yasmaddagbhasyatika tanutaravivrteranjasa tatkrtayah |
    premna vidvatsu bhuyah pracayamabhilasan raghavendra vratindra
    pravocastvam pratitavrata nicayamrcameva bhasyanurodhat ||28

    Meaning:
    Srimadaachaaryaru composed a wonderful work on the first forty sooktas of the Rig Veda known as Rig bhaashya. It is considered to be a pioneering work of its kind.It contains various nuances of the rig veda and had been commented upon by the great teekacharyaru. One day Lakshminarayanacharya ,the poorvaashrama son of the saint had presented a work on the same and His Holiness was extremely pleased by the work.

    hradyatrayyantavidyamukhanikhilakalatattvabodhaikamurte
    dhira sriraghavendravrativara sakalanyeva suktani samyak |
    vyakurvantam bhavantam vyavasitamatayo hanta nidhyasayantah
    sarve bhuyah smaranti vratasamitimanerbrahyasutrapranetuh || 29

    Dheera Sri Raghavendra!
    Your great elucidation on the sooktas namely Purusha sooktha,Hiranyagarbha sooktha,Ambhrini sooktha,Manyu sookta and Karma sooktha has created such a great impact on the scholars that it has impelled them to immediately think about Lord Sri Vedavyasaru . Such is the greatness of your work!!
    yavadvedantakhandapravacanakrtini premabhuma na taddaksarvamnayapravaktaryanupamacarite raghavendravratindre|ityetaddehabhajamativisadarucau jagaruke’pi lokerakacandre dvitiyasasisakalanatinyayamevanurundhe || 30
    O Guru Sarvabhauma your concern and benign blessings on your shishyas has been very much in this work!
    Your Holiness have been kind enough to write a wonderful khandartha on the ten principal upanishads like aitreya,shatprasna,brihadaranyaka,etc that had been commented upon Sri Madhvacharya. It can be said that Your Holiness have beeen appreciated and honoured for this work the most.This work makes the scholars to understand the dashopanishads more clearly and hence all are wholeheartedly thankful to Your Holiness for the same. This work is beautifully compared to the shukla paksha trutiyachandra darshana by the author.

    hradya tika’navadya paravivrtayajussamasambandhini temalinyaksalanambhah svayamajanihareruttarange ca murdhni |saivarca raghavendra vratisamitimane’nanyasamparkabhajamaujisthe daksinange mrgamadamilitodgarapatirasarah || 31
    Oh yatisreshta Sri Raghavendra Swamin! the gloss on Yajur and Sama veda written by Your Holiness is so wonderful that it has cleared all doubts on them hitherto like clearing the left shoulder of Sri Hari whereas that on the rig veda and upanishads have annointed sacred musk on the right shoulder of the Lord.Indeed great are your works!

    nunam vakyanurodhiprakaranamakhilam neyamityuktamuccaihpracam vacamyamena prakatitavibhavanantavedantavaca |svaminnetatpratiyah katamiva kavayo raghavendra vratindoyena tvadvakyajatam prakarananikaram tavadadyanurundhe ||32
    In this verse Sri Vadindra teertharu highlights the greatnesss of Mantralaya Mahaprabhu of giving a very lucid commentary on the dasaprakaranas of Srimad Ananda teertha bhagawad padaru in such a way that it can be easily understood by the readers. Only a great sainly scholar like Your holiness can only undertake such an arduous task and help the scholars.
    Sri Vadindraru states,that the tippani of Your Holiness brings to light the means of both the moola grantha and also the teekas of the dasaprakarana.

    Vikhyatasrisudhindravratisuta bhavata sadhugite sutarkesadyah pratyarthihradye munimaniracite tandave yojitarthe| pratyakhyataprakasah samajani bhuvane hanta cintamanistvambruhi sriraghavendravrativibudhamane kastvadanyo vadanyah ||33

    Sri Raghavendra Gurusarvabhauma, the uttama shishya of Sri Sudeendra and a great sanyasin is Your holiness is renowned for only being of great help to others. The great gloss called Nyyaya deepa on the wonderful workof Tarka tandava of Sri Vyasa Raja Gurusarvabhaumaru is so exquisite that it melts one heart and makes onedance with joy.

    praudhanekaprabandha pravacanaracanalabdhavistrabdhakirteste kim nyayamrtasyavivaranavidhina raghavendrayasah syat|yadrajyapracyavenakhilabhuvanapate raghavasyeva kirtih labdhaiva pratyutalam gurucaranakrtamodanirvahajanya ||34

    Mantralaya Mahaprabhu, though Your Holiness have not written a commentary on the nyaayamrita even then your eminence had been enhanced since Your holiness have exclusively taken it for paatha for your shishyas.It has already been highlighted in this work that two works of Sri Vyasa Raja Gurusarvabhauma,had been commented upon by Sri Parimalachaaryaru.

    Sri Vijayeendra Gurusarvabhauma,had already written a work called Amoda which had been wonderfully explained to the shishyas and hence the keerthi of Sri Rayaru had enhanced manifold.
    vaca sanksiptaya yadvahucaritamupavarnayastvam murareh
    kinca sriraghavendra vratipa raghupatestena no vismaye’ham|
    kimva duh sadhyamasti trijagati mahatamatmanah panipadme
    pasyamando marandah kilaghatajanusa colirakari sindhuh|| 35
    Meaning:
    This shloka highlights the greatness of two works Sri Rama charitra manjari and Sri Krishna charitra manjari which comprises of 11 verses and 28 verses respectively. The greatness of Sri Rayaru is clearly evident in these works where the great saint has condensed the crux of the great epic in just 11 verses and the entire dashama skanda of Sri Mad Bhagawatha in 28verses. The author of this poem also says that for great mahans like Sri Rayaru it is not a very big task.
    Sri Vadindraru beautifully gives an allusion about sage agastya who had just shrunk the entire ocean to help the gods . Indeed what is not possible by great personalities.

    mantrisrinilakanthabhidhamakhimanina bhattatantranubandhe
    granthe tavattvadiye karini gunavida ropite bhyarhanaya |
    kirtiste raghavendra vratisumatimane nunamanyunavega
    dirnaganaruruksuh svayamapi sahasa dyavadastau digantan || 36

    Meaning:
    The place is Madurai,the ruler tirumalai naicker and the minister is a great scholar Neelakanta dikshitar. Sri Rayaru in the course of his divine sojourn comes to Madurai where Neelakant dikshitar is highly impressed by theBhaatta Sangraha on Mimamsa and he places the work on an elephant and takes it in a big procession throughout the streets of Madurai. Sri Vadindraru wonderfully completes by opining “the fame of Your Holiness also spread all over the eight directions like how the glory of the book is spread”.

    vyasena vyuptabijah srutibhuvi bhagavatpadalabdhararasrih
    pratnairisatprabhinno’jani jayamunina samyagudbhinnasakhah|
    maunisavyasarajaduditakisalayah puspito’yam jayindra-dadya
    sri raghavendradvilasati phaliti madhvasiddhantasakhi ||37
    Meaning:
    The seeds of Brahma sutra was shown by vedavyasa in the field of vedas and which sprouted during the period of madhvacharya and during the period of teekakritpadaru it grew in to beautiful branches.During Vyasaraja’s Tirtha time new leaves made their appearance which later led way to the blooming of beautiful flowers by Sri Vijayendra Tirtharu and the tree of madhwa siddhantra bore wonderful fruits by Sri Mantralaya mahaprabhu and radiates brillliant effulgence all over.madyadadvaitavidyavadgarvanirvapanaksamah| vadindrayatirat tene bhaktya gurugunastavam ||38
    || iti srivadindratirthaviracitam sri gurugunastvanam ||
    ||Sri Krishnaarpanamasthu||

    Reply

  267. ನಾನೆನು ಮಾಡಿದೆನೊ ರಂಗಯ್ಯಾ ರಂಗಾ ನೀ ಎನ್ನ ಕಾಯಬೇಕೊ
    ಮಾನಾಭಿ ಮಾನವು ನಿನ್ನದುಯೆನಗೆನು ದೀನರಕ್ಷಕ ತಿರುಪತಿಯವೇಂಕಟರಮಣ || ಪ ||

    ರಕ್ಕಸ ಸೂದನನೆ ಕೇಳೋ ಧೃವರಾಯ ಚಿಕ್ಕವನಲ್ಲವೆನೋ
    ಉಕ್ಕಿಬರುವಾ ಕರ್ಮ ಮಾಡಿದ ಅಜಾಮೀಳ ನಿನ್ನಕ್ಕನ ಮಗನೆನೋ || ೧ ||

    ಕರಿರಾಜ ಕರೆಸಿದನೇ ದ್ರೌಪದಿ ದೇವಿ ಬರೆದೊಲೆ ಕಳುಹಿದಳೇ
    ಹರುಷದಿಂದಲಿ ಋಷಿ ಪತ್ನಿಯ ಶಾಪವ ಪರಿಹರಿಸಿದೆಯಲ್ಲೋ || ೨ ||

    ಮುಪ್ಪಿಡಿ ಅವಲಕ್ಕಿಯ ತಂದವನಿಗೆ ಒಪ್ಪುವಂತೆ ಕೊಡಲಿಲ್ಲವೆ
    ಸರ್ಪಶಯನ ಶ್ರೀ ಪುರಂದರ ವಿಠಲ ಅಪ್ರಮೆಯ ಕಾಯೋ || ೩ ||

    ನಾಹಂ ಕರ್ತಾ ಹರಿಃ ಕರ್ತಾ

    Reply

  268. do you have bhakti songs nanena madideno rangayya ranga ni yena kaya bekho in kannada lyrics,
    pls send urgently

    Reply

  269. ನಿನ್ನ ಅಂಗಳದೊಳಗೆ ಹಿಡಿ ಅನ್ನ ಹಾಕೋ

    ನಿನ್ನ ಅಂಗಳದೊಳಗೆ ಹಿಡಿ ಅನ್ನ ಹಾಕೋ ಘನ್ನ ಶ್ರೀಗುರುರಾಘವೇಂದ್ರ ಸಂಪನ್ನ || ಪಲ್ಲವಿ||

    ವರುಷ ವರುಷಕೆ ನಿನ್ನ ದರುಶನವ ದಯಮಾಡೋ | ದುರಿತ ನಾಶಗೈದು ಪರಿಶುದ್ಢಗೊಳಿಸೋ |
    ಅರಿತು ಅರಿಯದೆ ಗೈವ ಪಾಪಕರ್ಮವ ಕಳೆದು | ನಿರುತ ಶ್ರೀಹರಿ ಕೃಪೆಗೆ ಪಾತ್ರನಾಗಿರಿಸೋ || ೧||

    ನಿನ್ನ ಭಕುತರ ಪಾದ ರಜದೊಳೀಡಾಡಿಸೋ | ನಿನ್ನ ಗುಣಕೀರ್ತನೆಯ ಕಿವಿಗಳಲಿ ನಿಲಿಸೋ |
    ನಿನ್ನ ಪದೋದಕದಿ ಪಾವನ್ನ ಮಾಡೆನ್ನ | ನಿನ್ನ ರಘುಪತಿ ದಿವ್ಯ ದರುಶನವ ಕೊಡಿಸೋ || ೨||

    ಮಂತ್ರಸದನದಿ ನಿನ್ನ ಸಂತಸ ಮಹೋತ್ಸವದಿ | ಶಾಂತಿಸುಖ ಸಂಭ್ರಮದಿ ಸನ್ನಿಧಿಯೊಳಿರಿಸೋ |
    ಸಂತ ಶರಣರ ಭಕುತಿ ನೃತ್ಯಗೀತೆಗಳು | ನಿಂತು ನಲಿಯುವ ಭಾಗ್ಯ ಕೊಡು ಎನಗೆ ಪ್ರಭುವೇ || ೩||

    ಪ್ರಹ್ಲಾದ ರಾಯ ನೀ ಬಲ್ಲಿದನು ಜಗದೊಳಗೆ | ನಿಲ್ಲದೆ ಕಾಯ್ವ ನರಹರಿ ದೂತನಹುದೋ |
    ಎಲ್ಲ ರಾಜರ ರಾಜ ವ್ಯಾಸರಾಯನೆ ಸತ್ಯ | ಇಲ್ಲಿ ಶ್ರೀ ಪರಿಮಳಾರ್ಯರ ಮಹಿಮೆ ಸ್ತುತ್ಯ|| ೪||

    ಎನು ಬೇಡಲಿ ನಾನು ದಾನಿ ಕರ್ಣನು ನಿನ್ನ | ಜ್ಞಾನಿ ಸದ್ಗುರು ಕಲ್ಪವೃಕ್ಷ ಸುರಧೇನು|
    ದೀನ ರಕ್ಷಕ ವಿಠಲೇಶ ಕರುಣಾಭರಣ | ಸಾನು ರಾಗದಿ ನಿನ್ನ ಸೇವಕರೊಳಿಸೋ || ೫||

    ||ಶ್ರೀಮದ್ಗುರುವಂತರ್ಗತ ಶ್ರೀಭಾರತಿರಮಣ ಮುಖ್ಯಪ್ರಾಣಾಂತರ್ಗತ ಶ್ರೀಕೃಷ್ಣಾರ್ಪಣಮಸ್ತು ||

    ನಾಹಂ ಕರ್ತಾ ಹರಿಃ ಕರ್ತಾ

    Reply

  270. i wants bhakti songs nanena madideno rangayya ranga ni yena kaya bekho

    Reply

  271. Posted by Lakshman on June 14, 2013 at 5:45 am

    There are seven caraNAs for tAyE yashOdE. I have transliterated four. I will post the other three later. Only the first caraNa is usually sung.

    प: ताये यशोदे उन्दन आयर कुलत्तुदित्त मायन गोपालकृष्णन सोल्लुम जालत्तै केळडि
    अ: तय्यले केळडि उन्दन पय्यनै पोलावे इन्द वैयगत्तिल ओरु फिळ्ळै अम्मम्मा नान कण्डदिल्लै
    च१: कलील सिलम्बु क्नोज कै वळै कुलुङ्ग मुत्तु मालैगळ अशैय तेरु वासलिल वन्दान कालाशैयुम कैयाशैयुम ताळमोडु इसैंदु वर नील वण्ण कण्णन इवन नर्तनं आडिनान बालन एन्रु तवि अणैत्तेन अणैत्त एन्नै मालैयिट्टवन पोल वायिल मुत्तमिट्टाण्डि बालन अल्लादी उन मगन जालम मिग सेय्युम कृष्णन नालु पेर्गळ केट्क सोल्ल नणम मिगवागुदडि
    २: अनरोरु नाळ इन्द वज्ही वन्द विरुन्दिरुवम अयर्न्दु पदुततुरंगुम पोदिनिले कण्णन तिनरदु पोग कैयिल इरुन्द वेण्णैयै अन्द विरुन्दिनर वायिल निरैत्तु मरैन्दनने अन्द निन्दै मिगु नोन्दिडवुम सेय्य तगुमो नंदा गोपर्क्किन्द इन्द मिगु पिळ्ळै पेर नल्ल तवं सेइदारडि नाङ्गळ एन्न सेइमोमडि
    ३: एङ्गळ मनै वाश्ह वन्द ननगैयैत्तन्नम तनियाइ तुंगा यमुना नदिप्पोइगैयिले कण्णन सलंगैयुम इल्लादपडि पनगैयक्कण्णाल मयक्कि एङ्गेङ्गो अज्हैत्तु सेंरू निशि वन्दान उन मगन नान एनरान सोल्ली निंर पिन तडै इनरी वेण्णैत्तारुम एनरान
    ४: तोट्टिलिनिले पिळ्ळै किळॢ विट्टदुम अवन अलर विट्ट मट्टिलात्तुम्बै कज्हुत्तिल माट्टिक्कोण्डान विट्टु विट्टु अम्मे एनरान कन्रिनैप्पोले अट्टियिल्लाद माडुम अम्मा एन्रदे किट्टिन कुवळैयोडुम एट्टिनाल उन सेल्व मगळ पट्टियिल करवैयिडम पालै ऊट्टुरानडि

    Reply

    • Posted by Ranjini on June 20, 2013 at 10:02 am

      thank u very much….. plz post kannada meaning of guruguna stavana if u have…… thanks in advance.

      Reply

  272. Posted by Ranjini on June 13, 2013 at 11:31 am

    madam please post guru guna stavana by Sri Vadeendra tirtharu lyrics and meaning in Kannada…

    Reply

  273. Posted by PADMA on June 10, 2013 at 12:20 am

    Hi, do you have the lyrics in devanagiri for Taye Yashoda

    Reply

  274. Posted by Lakshman on June 4, 2013 at 7:00 am

    biDano ninnamghri. rAgA: ? no given tALA. Prasannavenkatadasa.

    P: biDano ninnanghri shrInivAsA enna duDisikolLelo shrInivAsA
    C1: ninna nuDiya jItallo shrInivAsA enna naDetappu kAyo shrInivAsA
    baDiyo bennali shrInivAsA nannoDala hoyyadiro shrInivAsA
    2: nA baDava kANelo shrInivAsA ninnoDala hokkeno shrInivAsA
    panjuviDiveno shrInivAsA ninnenjala baLidumbe shrInivAsA
    3: nA sanjI udayake shrInivAsA kALanjeya piDive shrInivAsA
    sattige cAmara shrInivAsA nAnetti kuNivEnO shrInivAsA
    4: ninna rattnada hAvige shrInivAsA nA hottu naliveno shrInivAsA
    hILidantAlipee shrInivAsA ninnALigALAgihI shrInivAsA
    5: avaruuLigava mAlpE shrInivAsA nanna pAlisO biDadE shrInivAsA
    ninna nAma hULigE shrInivAsA kalLa kunni nAnAgihE shrInivAsA
    6: kaTTi ninnavarOddarE shrInivAsA nanaginnu lajjEtakE shrInivAsA
    bIsi kOllalavarE shrInivAsA mudrE kAsi cuccalavarE shrInivAsA
    7: mikka ghAsiganjEnayya shrInivAsA enjalAsEya banTa nA shrInivAsA
    hEsi nAnAdarE shrInivAsA hari dAsaroLu pOkkE shrInivAsA
    8: avara bhASE kELihE shrInivAsA AvAsiya sairisO shrInivAsA
    tingalavanalla shrInivAsA vatsarangalavanalla shrInivAsA
    9: rAjangaLa savaDipE shrInivAsA bhavangaLa dATuvE shrInivAsA
    ninnava ninnava shrInivAsA nAnanyavanariyEnu shrInivAsA
    ayyA mannisO tAytandE shrInivAsA prasannavEnkaTAdri shrInivAsA

    Reply

  275. Posted by manjula on June 3, 2013 at 7:56 pm

    Dear Mira,
    Can you get me the lyrics of The song starting like this, ” Ninnangri Bideno Srinivasa “. It will end with ankithanama like this, Prasanna venkatadri Srinivasa”. Thanks a lot if you or any of our friends help me.
    manjula.

    Reply

  276. Posted by Gopal on May 19, 2013 at 10:30 pm

    Thanku Lakshmi!!!! Thanks a lot for your valuable reply..,

    Reply

  277. Posted by Lakshmi on May 17, 2013 at 5:37 pm

    http://stotraratna.awardspace.com/stotra/Shiva/sh12.pdf
    http://www.celextel.org/stotras/shiva/mahamrityunjayastotram.html

    These are two places that it is in english

    ಮಹಾ ಮೄತ್ಯುಂಜಯ ಸ್ರ‍ೋತ್ರಂ

    ಓಂ ಅಸ್ಯ ಶ್ರೀ ಮಹಾ ಮೃತ್ಯುಂಜಯ ಸ್ತೋತ್ರ ಮಂತ್ರಸ್ಯ

    ಶ್ರೀ ಮಾರ್ಕಾಂಡೇಯ ಋಷಿಃ ಅನುಷ್ಟುಪ್ ಛಂದಃ

    ಶ್ರೀ ಮೃತ್ಯುಂಜಯೋ ದೇವತಾ ಗೌರೀಶಕ್ತಿಃ ಮಮ ಸರ್ವಾರಿಷ್ಟ

    ಸಮಸ್ತ ಮೃತ್ತ್ಯುಶಾಂತ್ಯರ್ಥಂ ಸಕಲೈಶ್ವರ್ಯ ಪ್ರಾಪ್ತ್ಯರ್ಥಂ

    ಜಪೇ ವಿನಿಯೋಗಃ ಅಥ ಧ್ಯಾನಮ್

    ಚಂದ್ರರ್ಕಾಗ್ನಿವಿಲೋಚನಂ ಸ್ಮಿತಮುಖಂ ಪದ್ಮದ್ವಯಾಂತಃ ಸ್ಥಿತಮ್’

    ಮುದ್ರಾಪಾಶ ಮೃಗಾಕ್ಷ ಸತ್ರವಿಲಸತ್ ಪಾಣಿಂ ಹಿಮಾಂಶುಂ ಪ್ರಭುಮ್

    ಕೋಟೀಂದು ಪ್ರಹರತ್ ಸುಧಾಪ್ಲುತ ತನುಂ ಹಾರಾದಿಭೊಷೋಜ್ವಲಂ

    ಕಾಂತಂ ವಿಶ್ವವಿಮೋಹನಂ ಪಶುಪತಿಂ ಮೃತ್ಯುಂಜಯಂ ಭಾವಯೇತ್

    ಓಂ ರುದ್ರಂ ಪಶುಪತಿಂ ಸ್ಧಾಣುಂ ನೀಲಕಂಠಂಮುಮಾಪತಿಮ್

    ನಮಾಮಿ ಶಿರಸಾದೇವಂ ಕಿಂ ನೋ ಮೃತ್ಯುಃ ಕರಿಷ್ಯತಿ

    ನೀಲಕಂಠಂ ಕಾಲಮೂರ್ತಿಂ ಕಾಲಜ್ಞಂ ಕಾಲನಾಶನಂ

    ನಮಾಮಿ ಶಿರಸಾ ದೇವಂ

    ನೀಲಕಂಠಂ ವಿರೂಪಾಕ್ಷಂ ನಿರ್ಮಲಂ ನಿಲಯಪ್ರಭವ್

    ನಮಾಮಿ ಶಿರಸಾ ದೇವಂ

    ವಾಮದೇವಂ ಮಹಾದೇವಂ ಲೋಕನಾಥಂ ಜಗದ್ಗುರುಂ

    ನಮಾಮಿ ಶಿರಸಾ ದೇವಂ

    ದೇವದೇವಂ ಜಗನ್ನಾಥಂ ದೇವೇಶಂ ವೃಷಭಧ್ವಜಮ್

    ನಮಾಮಿ ಶಿರಸಾ ದೇವಂ

    ಗಂಗಾಧರ‍ಂ ಮಹಾದೇವಂ ಸರ್ವಾಭರಣಭೂಷಿತಮ್

    ನಮಾಮಿ ಶಿರಸಾ ದೇವಂ

    ಅನಾಥಂ ಪರಮಾನಂದಂ ಕೈವಲ್ಯಪದಗಾಮಿನಂ

    ನಮಾಮಿ ಶಿರಸಾ ದೇವಂ ಕಿಂ

    ಸ್ವರ್ಗಾಪವರ್ಗದಾತಾರಂ ಸೃಷ್ಟಿಸ್ಥಿತಿ ವಿನಾಶಕಮ್

    ನಮಾಮಿ ಶಿರಸಾ ದೇವಂ ಕಿಂ

    ಉತ್ವತ್ತಿಸ್ಥಿತಿಸಂಹಾರ ಕರ್ತಾರಮೀಶ್ವರಂ-ಗುರುಮ್

    ನಮಾಮಿ ಶಿರಸಾ ದೇವಂ ಕಿಂ

    ಮರ್ಕಂಡೇಯ ಕೃತಂ ಸ್ತೋತ್ರಂ ಯಃ ಪಠೇತ್ ಶಿವಸನ್ನಿಧೌ

    ತಸ್ಯ ಮೃತ್ಯುಭಯಂ ನಾಸ್ತಿನಾಗ್ನಿ ಚೋರಭಯಾತ್ ಕ್ವಚಿತ್

    ಶತಾವರ್ತಂ ಪ್ರಕರ್ತವ್ಯಂ ಸಂಕಟೇ ಕಷ್ಟನಾಶನಮ್

    ಶುಚಿರ್ಭೋತ್ವಾ ಪಠೇತ್ ಸ್ತೋತ್ರಂ ಸರ್ವಸಿದ್ಡಿ ಪ್ರದಾಯಕಮ್

    ಮೃತ್ಯುಂಜಯ ಮಹಾದೇವ ತ್ರಾಹಿಮಾಂ-ಶರಣಾಗತಮ್

    ಜನ್ಮ ಮೃತ್ಯು ಜರಾರೋಗೈಃ ಪೀಡಿತಂ ಕರ್ಮಬಂಧನೈಃ

    ತಾವಕಸ್ತ್ವದ್ಗತಪ್ರಾಣಸ್ವಚ್ಛಿತ್ತೋಹಂ ಸದಾಮೃಡ

    ಇತಿ ವಿಜ್ಜಾಪ್ಯ ದೇವೇಶಂ ತ್ರ್ಯಂಬಕಾಖ್ಯಂ ಮನುಂ ಜಪೇತ್

    ನಮಃ ಶಿವಾಯ ಸಾಂಬಾಯ ಹರಯೇ- ಪರಮಾತ್ಮನೇ-

    ಪ್ರಣತಕ್ಲೇಶ ನಾಶಾಯ ಯೋಗಿನಾಂ ಪತಯೇ ನಮಃ

    ಇತಿ ಮಹಾಮೃತ್ಯುಂಜಯ ಸ್ತೋತ್ರಂ

    Reply

  278. Posted by Gopal on May 17, 2013 at 6:01 am

    madam
    I am looking for Mrunthunjaya stotra if u have pls

    Reply

  279. Posted by Usha on March 27, 2013 at 12:43 am

    Hi Meera… I am looking for Prahalada Charithre in Kannada… Do you have the same?

    Reply

  280. Posted by Lakshman on March 15, 2013 at 7:52 am

    hakkiya hegalEri. rAgA : kannaDakAnbOji. Adi tALA. Prasannavenkatadasa.

    P: hakkiya hegalEri bandavage nODakka manasOte naanavage
    C1: satraajitana magaLettida unmatta narakadoLu kAdida
    matte keDahida avanangava satigittanu tA Alinganava
    2: hadinAru sAvira nAriyara sere mudadinda biDisi manOhara
    aditiya kuNDala kaLisida hari vidhisuranruparanu saluhida
    3: uttama prAgjOtiSapurava bhagadattage koTTa varAbhayava
    karta kruSNayyana nambide shrI mUrtiya pAdava hondide
    4: naraka caturdashi parvada dina haruSadi prakaTAdanu dEva
    sharaNAgatajana vatsalaa ranga parama bhAgavatara paripAla
    5: hogaLi kruSNayyana mahimeya mukti nagarada arasana kIrtiyA
    jagadIsha prasanvEnkaTEshanu bhaktaraghahAri ravikOTi prakAshanu

    Reply

  281. Posted by Alaka on March 15, 2013 at 6:09 am

    Hi, Can somebody post the lyrics for “hakkiya hegaleri bandagave”

    Alaka

    Reply

  282. Posted by Lakshman on March 7, 2013 at 12:19 pm

    Neel Pai: Please contact me at luzchurch@hotmail.com so that I can give you more details about books.

    Reply

  283. Posted by Lakshman on March 7, 2013 at 9:15 am

    jaganmOhananE. rAgA: behAg/SaNmukhapriyA. Adi tALA. Purandaradasa.

    P: jaganmOhananE krSNa krSNa jagava pAlipanE krSNa
    C1: ondu pAdava bhUmiyalUri mattondu pAdava gaganavanaLedu
    ondupAda bali rSiradale iTTe inthA vidyavanelli kaliteyO ranga?
    2: lOkadoLage nI shishuvAgi mUru lOkavanella bAyalli tOride
    AkaLa kAyuva chiNNanemdeniside I kuTilavanella elli kaliteyO ranga
    3: endendigu nimma guNagaLannu pogaLalu indrAdigaLige aLavalla
    mandharadhara shrI purandara viTTalanE ondondATavanelli kaliteyO ranga

    vrndAvanavE mandiravAgiha. rAgA: saurASTra. aTa tALA. Purandaradasa.

    P: vrndvanavanavE mandiravAgiha indire shrI tulasi
    A: namma nandana mukundage priyavAda cendAda shrI tulasi
    C1: tulasi vanadalli ihanembOdu shruti sArutide kELi tulasi darshanadinda duritagaLella haridu hOgOdu kELi
    tulasi sparsahanadinda dEha pAvanavendu nIvella tiLidu kELi tulasi smaraNe mADi sakaliSTava baDedu sukhadali nIvu bALi
    2: mUla mrttikeyanu dharisida mATradi mUru lOka vahavAhudu mAlegaLane koraLalliTTa manujake mukti mArgava nIvudu
    kAla kAlagaLali mADida duSkarma kaLedu bisuTu hOgOdu kAlana dUtara aTTi kaivalyava lIleya tOruvudu
    3: dhareyoLu su-janara mareyade salahuva vara lakSmI shrI tulasi parama bhaktara pApagaLella taridu pAvana mADuvaLu tulasi
    siri Ayu putrAdi sampattugaLanittu haruSavIvaLu tulasi purandara viTTalanna smaraNe koDuvaLu tulasi

    Reply

  284. Posted by Pravina N kamath on March 7, 2013 at 3:41 am

    can i get the lyrics of songs 1. vrindavanave mandiravagide 2.jaganmohanane krishna in kannda.
    i am waiting for your reply.

    Reply

    • ಬೃಂದಾವನವೇ ಮಂದಿರವಾಗಿದೆ ಇಂದಿರೆ ಶ್ರೀ ತುಳಸಿ|ಪ|
      ನಂದ ನಂದನ ಮುಕುಂದಗೆ ಪ್ರಿಯಳಾದ ಚಂದದ ಶ್ರೀ ತುಳಸಿ |ಅ.ಪ|

      ತುಳಸಿಯ ವನದಲಿ ಹರಿ ಇಹನೆಂಬುದ ಶೃತಿ ಸಾರುತಿದೆ ಕೇಳಿ
      ತುಳಸಿ ದರ್ಶನದಿಂದ ದುರಿತಗಳೆಲ್ಲವು ದೂರವಾಗುವುದು ಕೇಳಿ
      ತುಳಸಿ ಸ್ಪರ್ಶವ ಮಾಡೇ, ದೇಹಪಾವನವೆಂದು ತಿಳಿಯುದಿಲ್ಲವೇ ಕೇಳಿ
      ತುಳಸಿ ಸ್ಮರಣೆ ಮಾಡಿ ಸಕಲ ಇಷ್ಟವಪಡೆದು ಸುಖದಲಿ ನೀವು ಬಾಳಿ |೧|

      ಮೂಲ ಮೃತ್ತಿಕೆಯನು ಮುಖದಲಿ ಧರಿಸಲು ಮೂರ್ಲೋಕ ವಶವಹುದು
      ಮಾಲೆ ಕೊರಳಲಿಟ್ಟ ಮನುಜಗೆ ಮುಕುತಿಯ ಮಾರ್ಗವ ತೋರುವುದು
      ಕಾಲ ಕಾಲಗಳಲಿ ಮಾಡಿದ ದುಷ್ಕರ್ಮ ಕಳೆದು ಬಿಸಾಡುವದು
      ಕಾಲನ ದೂತರ ಕಳಚಿ ಕೈವಲ್ಯದ ಲೀಲೆಯ ತೋರುವುದು |೨|

      ಧರೆಯೊಳು ಮರೆಯದೇ ಸುಜನರ ಸಲಹುವ ವರಲಕ್ಷ್ಮೀ ಶ್ರೀ ತುಳಸಿ
      ಪರಮ ಭಕ್ತರ ಘೋರ ಪಾಪಗಳ ತರಿದು ಪಾವನ ಮಾಡುವ ತುಳಸಿ
      ಸಿರೀಯಾಯುಪುತ್ರಾದಿ ಸಂಫಲಗಳನಿತ್ತು ಹರುಷಗೊಳಿಪ ತುಳಸಿ
      ಪುರಂದರ ವಿಠಲನ ಚರಣ ಕಮಲಗಳ ಸ್ಮರಣೆಕೊಡುವ ತುಳಸಿ|೩|

      You will find the lyrics for .jaganmohanane krishna here.

      http://www.mayyam.com/talk/showthread.php?4847-Lyrics-queries-and-meaning-Kannada/page8

      I would like to thank Shree Lakshman.Keep the good work going.If you have any books / source for Daasara padagalu or Daasa Saahitya please let me know.Thank You Again.

      Shree Krishnarpanamastu.
      Dev Bare Karo.

      Reply

      • Posted by pravina n kamath on March 7, 2013 at 11:58 am

        thank you for your reply do post more lyrics if you have

      • Posted by Bhavana on November 6, 2013 at 6:45 am

        Dear neel pai,

        Please give audio link for ಬೃಂದಾವನವೇ ಮಂದಿರವಾಗಿದೆ ಇಂದಿರೆ ಶ್ರೀ ತುಳಸಿ|

  285. Posted by kishore on February 23, 2013 at 11:54 am

    do any one have the album “Haridasa Nada SAurabha ” sung by sindhura moorthy?
    pl share

    Reply

  286. Posted by sujatha on February 14, 2013 at 6:52 pm

    is very good , is this dasara padagalu

    Reply

  287. Posted by Lakshman on February 13, 2013 at 9:04 am

    shrngapurAdhIshvari. rAgA: kalyANi. Adi tALA. Composer: A.V.Krishnamachar. (Padmacharan)

    P: shrngapurAdhIshvarI shAradE shubha mangaLE sarvAbhISTapradE
    A: shankara sannuta shrIpadmacaraNE sakalakalA
    vishAradE varadE salahenna tAye sAmagAnapriyE
    C: karuNisemma shruti gatigaLa mAtE kamanIya sapta svara supUjitE
    kAvyagAna kalA svarUpiNi kAmita dAyini kalyANi jananI

    Reply

  288. Posted by Chaitra on February 13, 2013 at 7:45 am

    namaste madam..

    can i please know where i can here the song saari bandane pranesha bandane….

    Reply

  289. Posted by Chaitra on February 13, 2013 at 7:14 am

    can i get the lurics of the song shrungapuradishvari sharade

    Reply

  290. hi meera…
    ur blog is amazing i have tried food corner also…. i would like to tell u that while surfing on net for lyrics i got site with name AARSHVANI… many well known bhajans are available with lyrics meaning in hindi english kannada and tamil too… u must see that site… and gr8 job and all the very best….. keep it up

    Reply

  291. Posted by krishna on February 8, 2013 at 4:32 am

    HI can i get the lyrics of the stotram.
    Also what is the name of the stotram.
    “Ohm hara poorvika devi veena pusthaka tharini veda matha namasthubyam”

    Reply

  292. Posted by Sreehari.P. on February 2, 2013 at 3:55 pm

    Dear Ms. Meera,

    Please provide me your mail id here or mail me at sreeharipurohit@gmail.com. I am trying to collect some details and scriptures all together with daasa sahitya and other many documents. May be I could be of help to you.

    You can expect the documents very shortly. 🙂

    Reply

  293. Dear Mira,
    Can you give lyrics for ” Narasimha Deva Nembo” song. I am waiting for it since long. Much obliged if you give.Thanq.

    Reply

    • Posted by meeraghu on January 27, 2013 at 9:09 am

      Manjula,
      It is Meera and not Mira. Also, the lyrics for that have been long posted, please check the lyrics page.

      Reply

  294. Posted by divya v.n on January 19, 2013 at 4:11 am

    hi,

    this website is really good and having lot of good songs, slokas, thanks for your efforts.

    Reply

  295. Posted by Lakshman on January 17, 2013 at 11:28 am

    Here is my best attempt. Corrections welcome.

    sEvakanelo nAnu. rAgA: madhyamAvati. rUpaka tALA. Vadirajasvami.

    P: sEvakanelo nAnu ninnaya pAda sEveniDelo nInu
    A: sEvekanelo nAnu tEdeniDelO nInu kAvudEnelo shrI vadhUvara rAvaNAntaka rakSitennanu
    gOvardhanadhara dEva hOvugaLa kAva shrI mananubhAva varagaLa nIva dEvA
    (madhyamakAla)
    shrI vallabha dayamADennoLu IvELage indirA ramaNa
    C1: rAma dasharatha nandanA raghukulAmbudhi sOmasundara vadana
    vAma paripurNa kAma kausalyA rAma svAmi shrI rangadhAma daitya virAma shrI madanantanAma
    shrIman munijana stOma ramyaguNa dhAma raNaranga bhIma kOmala shyAma rAmA
    (madhyamakAla)
    sAmajavaradAnanda nidhi kAmaita phala karunidhi kAyO
    2: shankara sura sEvitA shESa garuDAlankAra maNI bhUSitA
    pankajasana nayana ninAbnka janaka pAda pankAjAsana vinuta tirupati venkaTa dirdAnaka jaya jaya
    shankhA shankha cakradhari pankajadhara akaLanka carita ATanka olida nisshankhA
    (madhyamakAla)
    lankAdhipa lAlita raghupati kinkArike kinkari nAnenu
    3: mandaharadhara mAdhavA madhusUdanAnanda sundara viThalA
    indu mAdhava gOvinda gOkulAnada sangitAmara brnda vEdava tanda turagavanEri banda
    brndAvanadoLaginda yashOdeya kanda harigOvinda shESagiriyalininda
    (madhyamakAla)
    mandAkini draupadi dhruvapari nandaniyenapari hayavadana

    Reply

  296. Posted by Ranjini on January 15, 2013 at 5:53 am

    since the song goes fast in the charanam i dint get the lyrics of sevakanelo naanu song……….. thanks for the audio.. please provide the lyrics if you get……….

    Reply

  297. Posted by Ranjini on January 14, 2013 at 3:01 am

    Pls provide the lyrics of the song “Are Ghaligeyu ninna smarane bidenu shri Raghavendra Karuna Saandra” and also please please provide lyrics of “Sevakanelo Naanu” if you get………… Thanks in advance madam.

    Reply

  298. Posted by Lakshman on January 11, 2013 at 8:40 am

    hari krpeyali tAnoliddAdare. rAgA: dhanyAsi. Adi tALA. Purandaradasa.

    P: hari krpeyali tAnoliddAdare urutara mOkSave sAkSi
    A: hari sharaNara sEvisuva nararige dhareya saukhyave sAkSi
    C1: maDadi makkaLa sAgade biDuvage kaDu dAridryave sAkSi
    kaDu baDavage dharmava koDadire bAyi biDuvade pararige sAkSi
    2: anna dAnava mADidavage divya anna umbuvade sAkSi
    honnu dAnava mAdadavage para dainya baDuvude sAkSi
    3: kanyA dAnava mADidavage divya heNNina bhOgavE sAkSi
    kanyA dAnava mADadavge heNNina hOrATave sAkSi
    4: kaNDa puruSage kaNNikkuvaLige gaNDana kaLevude sAkSi
    bhaNTatanadi para strIyara meccuvage heNDira kaLevude sAkSi
    5: kSEtra dnava mADidavage Eka chatra rAjyave sAkSi
    pAtrApAtravanaridu dAna mADidavage putrara paDevude sAkSi
    6: paripari tAnuNDu parari kondikkada narage gulma rOgave sAkSi
    paripariyindali hiriyara dUSise tiridumbOde balu sAkSi
    7: bhaktiyillada adhamarigondu kattale maneya sAkSi
    mukti paDevudake shrI purandara viTTalana bhaktanAgiruvude sAkSi

    Reply

  299. Posted by jamuna on January 10, 2013 at 4:24 pm

    I just happened to stumble onto this website and see that Ms. Meera has a wealth of informtion re lyrics of old and not so frequently heard songs. I am looking for the lyrics of a song sung by my grandmother who of course is not here anymore.
    the few words i know are:
    Hari pada gala nitya neneyu adare…somthing)(
    parama paratpare saakshi;
    then it goes on to say:
    anna daanava maadida manujage
    akshya paatravu saakshi

    and then another verse started with:
    kanya daanava maadida manujage……
    If by any chance you would know this song… iwill be very grateful. thank you very much.
    jsrinivas@gmail.com

    Reply

  300. Posted by sujatha on January 8, 2013 at 8:50 am

    i want udupiya kandeera composer

    Reply

  301. Posted by sujatha on January 8, 2013 at 8:48 am

    i want ondhu kaladhalli ughabhoga

    Reply

    • Posted by bhavana on January 8, 2013 at 11:23 am

      ಒಂದು ಕಾಲದಲ್ಲಿ ಆನೆ ಕುದುರೆ ಮೇಲ್ಮೆರೆಸುವೆ
      ಒಂದು ಕಾಲದಲ್ಲಿ ಬರಿಗಾಲಲ್ಲಿ ನಡೆಸುವೆ
      ಒಂದು ಕಾಲದಲ್ಲಿ ಮೃಷ್ಟಾನ್ನವುಣಿಸುವೆ
      ಒಂದು ಕಾಲದಲ್ಲಿ ಉಪವಾಸವಿರಿಸುವೆ
      ನಿನ್ನ ಮಹಿಮೆಯ ನೀನೆ ಬಲ್ಲೆಯೊ ದೇವ
      ಪನ್ನಗಶಯನ ಶ್ರೀ ಪುರಂದರವಿಠಲ
      oMdu kaaladalli aane kudure mElmeresuve
      oMdu kaaladalli barigaalalli naDesuve
      oMdu kaaladalli mRuShTaannavuNisuve
      oMdu kaaladalli upavaasavirisuve
      ninna mahimeya nIne balleyo dEva
      pannagashayana shrI puraMdaraviThala

      Reply

  302. Posted by Chaitra on December 29, 2012 at 6:27 am

    can you plz post the lyrics of the song dimbadalliruva jeeva kamba sutra bombeyante

    Reply

    • ರಚನೆ : ಶ್ರೀ ಕನಕ ದಾಸರು

      ದಿಂಬದಲ್ಲಿರುವ ಜೀವ ಕಂಬ ಸೂತ್ರ ಗೊಂಬೆಯಂತೆ,
      ಎಂದಿಗಾದರೊಂದು ದಿನ ಸಾವು ತಪ್ಪದ್ದೊ ,
      ಎಂದಿಗಾದರೊಂದು ದಿನ ಸಾವು ತಪ್ಪದ್ದೊ

      ಹುಟ್ಟುತ್ತೇನೆ ತರಲಿಲ್ಲ ,ಸಾಯುತೇನು ಒಯ್ಯಲಿಲ್ಲ
      ಸುಟ್ಟು ಸುಟ್ಟು ಸುಣ್ಣದಗಳು ಆಯಿತೀ ದೇಹ.
      ಹೊಟ್ಟೆ ಬಲು ಕೆಟ್ಟದೆಂದು ಎಷ್ಟು ಕಷ್ಟ ಮಾಡಿದರು
      ಬಿಟ್ಟು ಹೋಗುವಾಗ ಗೇಣು ಬಟ್ಟೆ ಕಾಣರೋ

      ಹತ್ತು ಎಂಟು ಲಕ್ಷ ಗಳಿಸಿ ಮತ್ತೆ ಸಾಲದೆಂದು
      ಪರರ ಅರ್ಥಕ್ಕಾಗಿ ಆಸೆ ಪಟ್ಟು ನ್ಯಾಯ ಮಾಡ್ವರೋ
      ಬಿಟ್ಟಿ ಬೆಳೆಸು ತನ್ನದೆಂದು ವ್ಯರ್ಥ ಚಿಂತೆಯನ್ನು ಮಾಡಿ
      ಸತ್ತು ಹೋದ ಮೇಲೆ ಅರ್ಥ ಯಾರಿಗಾಗುದೋ.

      ಹೆಣ್ಣು ಹೊನ್ನು ಮಣ್ಣು ಮೂರು ತನ್ನಲಿದ್ದೂ ಉಣ್ಣಲಿಲ್ಲ
      ಅಣ್ಣ ತಮ್ಮ ತಾಯಿ ತಂದೆ ಬಯಸಲಾಗದೊ
      ಅಣ್ಣ ವಸ್ತ್ರ ಭೋಗಕ್ಕಾಗಿ ತನ್ನ ಸುಖವ ಕಾಣಲಿಲ್ಲ
      ಮಣ್ಣು ಪಾಲು ಆದ ಮೇಲೆ ಯಾರಿಗಾಗುದೋ

      ಬೆಳ್ಳಿ ಬಂಗಾರಿಟ್ತುಕೊಂಡು ಒಳ್ಳೇ ವಸ್ತ್ರ ಹೊದ್ದುಕೊಂಡು
      ಚಳ್ಳ್ ಪಿಳ್ಳ್ ಗೊಂಬೆಯಂತೆ ಆಗಿ ಹೋದೆನೇ
      ಹಳ್ಳ ಹರಿದು ಹೋಗುವಾಗ ಗುಳ್ಳೆ ಬಂದು ಒಡೆಯುವಂತೆ
      ಗುಳ್ಳೆ ಪೊರೆಯಂತೆ ಕಾಣೊ ಸಂಸಾರದಾಟ

      ವಾರ್ತೆ ಕೀರ್ತಿ ಎಂಬೋ ಎರಡು ಸತ್ತ ಮೇಲೆ ಬಂದವಯ್ಯ
      ವಸ್ತು ಪ್ರಾಣ ನಾಯಕನು ಹ್ಯಾಂಗೆ ದೊರಕುವನೋ
      ಕರ್ತೃ ಕಾಗಿನೆಲೆಯಾದಿ ಕೇಶವನ ಚರಣ ಕಮಲ
      ನಿತ್ಯದಲಿ ಭಜಿಸಿ ಸುಖೀಯಾಗಿ ಬಾಳೇಲೋ
      ಸುಖೀಯಾಗಿ ಬಾಳೇಲೋ

      Reply

  303. Posted by Deepa Shenoy on December 24, 2012 at 5:53 am

    Pls can anyone send the lyrics of ‘O yennuva ganapa karedaaga,o yennuva ganapa’… in english or kannada…

    Reply

  304. Posted by Lakshman on December 16, 2012 at 2:48 pm

    rAghavEndra yati. rAgA: dhanyAsi/bilAval. Adi/kaharvA tALA.

    P: rAghavEndra yati sArvabhauma duritaugha dUra tE namO namO
    mAgadharIpumata sAgara mIna mahAgha vinAshana namO namO
    A: shlAgita guNagaNa sUri prasanga sadAgamajna tE namO namO
    mEgha shyAmala rAmArAdaka mOgha bOdha tE namO namO
    C1: tungabhadra sutarangiNi tIraga mangaLa carita shubhAnga namO
    ingitajna kALinga mardhana yadupungava hrdaya turanga namO
    sangira cihnita shrngArAnana tingaLa karuNApAnga namO
    gAngEya sama bhAnga kumata mAtanga sangha citapinga namO
    2: kOvida mastaka shObhita maNI smbhAvita mahima pAlayamAm
    sEvApara sarvArthaprada brndAvana mandira pAlayamAm
    bhAvaja mArgaNa bhujaga vinAyaka bhAvajna priya pAlaya mAm
    kEvala nutajana pAvana rUpa sadA vinOdi hE pAlaya mAm
    3: shrI sudhIndra karajAta namO namO bhUsura vinuta vikhyAta namO namO
    dEshika vara samsEvya namO namO dOSa vivarjita kAvya namO
    klEshita jana paripala namO namO bhUSita karuNA shIla namO
    vyAsarAya pada bhakta namO namO shAsvata dharmAsakta namO
    4: sannuta mahima shrI jagannAtha viThala sahnita mAnasa jaya jaya bhO
    cihnita daNDa kamaNDala puNDra prapanna bhayApaha jaya jaya bhO
    mAnya mahAtma prasanna vadana kAruNyapayOnidhi jaya jaya bhO
    dhanya kSEma sampannadharAmara sharaNya sadArthita jaya jaya bhO

    Reply

  305. Posted by shiva prakash on December 2, 2012 at 7:14 am

    can someone write english translation of the song written by Jagannatha Dasaru on raghavendra swami:

    rAghavEndra yati sArvabhauma duritaugha dUra tE namO namO
    mAgadharIpumata sAgara mIna mahAgha vinAshana namO namO

    full lyrics is at http://www.sumadhwaseva.com/wp-content/uploads/2009/02/jagannathadasaru.pdf

    Reply

  306. Posted by Gayatri on November 18, 2012 at 5:04 pm

    Excellent collection. Thanks for the great work.
    I have been looking for lyrics and audio of these arathi songs that my grandma used to sing: They have these lyrics – don’t have much to go on:
    One : – Indira Kanthanige Indira Rakshanige

    and the other:

    Vigneswara Siddhidhayanige vidhyavanala Koduvanige

    Not sure how easily available they are but if you have heard of them can you post the lyrics and guide me on where I can find audio,

    Thanks

    Gayatri

    Reply

  307. Posted by bhavana on November 17, 2012 at 8:15 am

    Meera,
    There is another song starting with the words “Sevakanelo naanu”
    Ranjini may be looking for that.

    Reply

  308. Posted by Ranjini on November 16, 2012 at 1:17 am

    This site is really Very informative…… please can anyone provide me the lyrics of the song “Sevakanelo naanu ninnaya paada seve needelo neenu” in Kannada?

    Reply

    • Posted by lakshmi baharthi on November 16, 2012 at 3:50 pm

      ಬಾರೋ ಗುರು ರಾಘವೇಂದ್ರ ಬಾರಯ್ಯ ಬಾ ಬಾ
      ಹಿಂದು ಮುಂದೆಲ್ -ಲೆನಗೆ ನೀ -ಗತಿ
      ಎಂದು ಪೊಂದಿದೆ ನಿನ್ನ ಪಾದವ
      ಬಂಧನವ ಬಿಡಿಸೆನ್ನ ಕರಪಿಡಿ
      ನಂದ ಕಂಡ ಮುಕುಂದ ಬಂಧೋ

      ಸೇವಕನೆಲೋ ನಾನು ನಿನ್ನಯ ಪಾದ
      ಸೇವೆನೀಡೆಲೋ ನೀನು
      ಸೇವಕನ ಸೇವೆಯನು ಸೇವಿಸಿ
      ಸೇವ್ಯ ಸೇವ್ಯಕ ಭಾವ ವೀಯುತ
      ಧಾವಿಸೇನ್ನನು ಪೊರೆಯೋ ಧರೆಯೊಳು
      ಪವನಾತ್ಮಕ ಕಾಯೋ ಕರುಣಿಸಿ

      ಕರೆದರೆ ಬರುವೀಯೆಂದು ಸಾರುವುದು ಡಂಗೂರ
      ತ್ವರಿತಡಿ ಒದಗೋ ಬಂದೂ
      ಜರೆಯು ವ್ಯಾಧಿಯು ಬಾರದೆ ನಿನ್ನ
      ವಿರಹ ತಾಳದೆ ಪಾದಕೆ ಎರಗುವೆ
      ಹರಿಯ ಸ್ಮರೆಣೆಯ ನೀಡುತೆನಗೆ
      ಹರುಷದಲಿ ನೀ ನಿರುತ ಕೊಡುತಲಿ

      ನರಹರಿ ಪ್ರಿಯನೇ ನೀ ಬಾ ಗುರು ಶ್ರೀಶ ವಿಠಲನ
      ಕರುಣಾ ಪಾತ್ರನೆ ಬೇಗ ಬಾ
      ಗುರುವರನೆ ನೀ ಪರಿತೋಷಿಸೇನ್ನನು
      ಮರೆಯದಲೇ ತವ ಚರಣ ಕೋಟೆಯ
      ಲಿರಿಸಿ ಚರಣಾಂಬುಜವ ತೋರುತ
      ತ್ವರಿತದಲಿ ಓಡೋಡಿ ಬಾ ಬಾ

      Reply

  309. Posted by lakshmi baharthi on November 14, 2012 at 8:20 pm

    sorry forgot to mention this is in kannada — of earlier posted song

    Reply

  310. Posted by lakshmi baharthi on November 14, 2012 at 8:17 pm

    ನಾರಾಯಣ ಎನ್ನಿರೋ , ಶ್ರೀ ನರಹರಿ ಪಾರಾಯಣ ಮಾಡಿರೋ
    ನಾರಾಯನನೆಮದು ಅಜಾಮಿಳನು ಕೈವಲ್ಯ
    ಸೇರಿದನು ಎಂಬೋ ಸುದ್ದಿ ಕೇಳಿ ಅರಿಯಿರಾ ||

    ಕಾಶಿಗೆ ಹೋಗಲೆಕೆ , ಕಾವಡಿ ಪೊಟ್ಟು ಬೇಸತ್ತು ತಿರುಗಲೇಕೆ
    ವಾಸುದೇವನ ನಾಮ ಬಾಯ್ತುಂಬ ನೆನೆದರೆ
    ಕ್ಲೆಶಗಳೆಂಬುದು ಲೇಶ ಮಾತ್ರವಿಲ್ಲ ||

    ಚೋರರ ಭಯವಿಲ್ಲವೋ , ಹರಿನಮಾಕ್ಕೆ ಯಾರ ಅಂಕೆಯಿಲ್ಲವೋ
    ಉರನಾಳುವ ಧೊರೆ ನೀತಿ ಭಿತಿಗಲಿಲ್ಲ
    ಘೋರಪತಕವೆಲ್ಲ ದೂರ ಮಾಡುವುದಕ್ಕೆ ||

    ಸ್ನಾನವ ಮಾಡಲೇಕೆ , ಮಾನವರಿಗೆ ಮೌನ ಮಂತ್ರಗಲೇಕೆ
    ದಿನಪಾಲಕ ನಮ್ಮ ಬೆಟ್ಟ ದೊಡೆಯನ
    ಧ್ಯಾನಕೆ ಸರಿಯುಂಟೆ ಪುರಂದರ ವಿಠಲನ ||

    Reply

  311. svAmi mukhya prANa nI. rAgA: Anandabhairavi. Adi tALA.

    P: svAmi mukhya prANa nI malevara gaNDala gANa sakala vidyA pravINa nI hiDidyO rAma a caraNa
    C1: sanjIvini parvatavannu anjade tandeyO nInu anjane tanu sambhavanu ninna bEDi kombEnO nAnu
    2: vaikuNTha sthaLadinda bandu pampA kSEtradi nindu yantrOddhArakanendu purandara viTTalane sahanendu

    Reply

    • Posted by meeraghu on October 30, 2012 at 6:14 pm

      Can we get this in Kannada?

      Reply

      • Posted by bhavana on November 13, 2012 at 7:23 am

        ಸ್ವಾಮಿ ಮುಖ್ಯಪ್ರಾಣ ನೀ ಮಲೆವರ ಗಂಟಲಗಾಣ ||ಪ||
        ಸಕಲ ವಿದ್ಯಾಪ್ರವೀಣ ನೀ ಹಿಡಿದೆಯೊ ರಾಮರ ಚರಣ ||ಅ.ಪ||

        ಏಕಾದಶೀಯ ರುದ್ರ ನೀ ಹಿಡಿದೆಯೋ ರಾಮರ ಮುದ್ರ
        ಸೇತುವೆಗಟ್ಟಿ ಸಮುದ್ರ ನೀ ಹಾರಿದೆಯೋ ಬಲಭದ್ರ ||೧||

        ಸಂಜೀವಿನಿ ಪರ್ವತವನ್ನು ಅಂಜದೆ ತಂದೆಯೋ ನೀನು
        ಅಂಜನೆತನುಸಂಭವನು ನಿನ್ನ ಬೇಡಿಕೊಂಬೆನೊ ನಾನು ||೨||

        ವೈಕುಂಠಸ್ಥಳದಿಂದ ಬಂದು ಪಂಪಾಕ್ಷೇತ್ರದಿ ನಿಂದು
        ಮಂತ್ರೋದ್ಧಾರಕನೆಂದು ಪುರಂದರವಿಠಲನೆ ಸಲಹೆಂದು ||೩||

        (ಆಕರ ಗ್ರಂಥ: ಪುರಂದರ ಸಾಹಿತ್ಯ ದರ್ಶನ)

        You can listen the song here:

  312. Posted by guruprasath on October 30, 2012 at 12:55 pm

    can any one provide me rayaru gadhya if its in devanagari its better otherwise even its in english ok

    Reply

  313. Posted by vinod on October 30, 2012 at 1:17 am

    Hi Meera,

    The hardship taken by you to keep this good job going cannot be expressed by mere words.I really dont know how to express…..:)
    Would you be able to upload swamy mukhyaprana composition of sri purandara dasaru…..

    Cheers,
    Vinod

    Reply

  314. Thanks so much Meera avare…I remember the lyrics which goes on praising lord Govinda..Probably there’s more than one variation to this song… But again thanks a lot.

    Reply

    • The original Lyrics by Shree Purandara Dasaru

      ಚಿಂತ್ಯಾಕೆ ಮಾಡುತಿದ್ದಿ ಚಿನ್ಮಯನಿದ್ದಾನೆ ,ಪ್ರಾಣಿ ಚಿನ್ಮಯನಿದ್ದಾನೆ
      ಚಿಂತಾರಾತ್ಮನೆಂಬೊ ಅನಂತನಿದ್ದಾನೆ,ಪ್ರಾಣಿ ಅನಂತನಿದ್ದಾನೆ.

      ಎಳ್ಳು ಮೊನೆಯ ಮುಳ್ಳು ಕೊನೆಯ ಪೋಳ್ಳು ಬಿಡದೆ ಒಳಗೆ ಹೊರಗೆ

      ಎಲ್ಲ ಠಾವಿನಲ್ಲು ಲಕುಮಿ ನಲ್ಲನಿದ್ದಾನೆ,

      ಭೋಕ್ತ ,ತ್ರಿಜಗ ವ್ಯಾಪ್ತ ,ಭಜಕರ ಆಪ್ತನೆನಿಸಿ ಸ್ತಂಭದಲ್ಲಿ ,

      ಪ್ರಾಪ್ತನಾದ ಪ್ರಃಹಲಾದನ ಪರಮಾತ್ಮನಿದ್ದಾನೆ.

      ಹಿಂದೆ ನಿನ್ನ ಸಲುಹಿದರ್ಯಾರು, ಮುಂದೆ ನಿನ ಕೊಲ್ಲುವವರ್‍ಯಾರು

      ಅಂದಿಗ್ ಇಂದಿಗ್ ಎಂದೆಂದಿಗೂ ಗೋವಿಂದನಿದ್ದಾನೆ,

      ನಾನು ನನ್ನದು ಎಂಬುದು ಬಿಟ್ಟು ಹೀನ ವಿಷಯಂಗಳನೆ ಜರಿದು,

      ಜ್ಞಾನಗಮ್ಯ ಕಾಯೋ ಎನಲು ಪೂರ್ಣನಿದ್ದಾನೆ ಪ್ರಾಣಿ.

      ಸುತ್ತಲಿ ಬಂದ ದುರಿತಗಳೆಲ್ಲ ಕತ್ತರಿಸಿ ಕಡಿದು ಹಾಕುವ,

      ಹೆತ್ತ ತಾಯಿ ತಂದೆ ತವರು ಹತ್ತಿಗನಿದ್ದಾನೆ,

      ಬಳಿದ ಭಜಕರ ಹೃದಯದಲಿ ನಿಂತು ಮುದ್ದು ಪುರಂದರ ವಿಠಲ

      ಸೋಲ್ಲೂ ಸೋಲ್ಲಿದವರ ಬಯಕೆ ಸಲ್ಲಿಸುತಿದ್ದಾನೆ, ಪ್ರಾಣಿ.

      Reply

  315. You can hear the song here:

    Reply

  316. Namaskara Ma’m. I need “chinteyake maduthi Shri Chinmayaniddanae ” lyrics. I did search but couldn’t find it though. Thanks in advance.

    Reply

    • Please note: these are not the original lyrics.It is according to the Song sung by P.N.Nayak, I dont have d Original lyrics,I have read the original lyrics but dont have it now,I’ll try uploading it as I get it.

      Chintyaake maadutiddi Chinmayniddane,
      ninna chinteya bidisuva gauri kaantaniddane.

      Ellu koneyu mullu moneyu pollu bidada olage horage,
      ella thavinallu gauri vallabha niddane.

      Hinde ninna salahidaryaaru,munde ninna salahuvaryaaru,
      andindendendigu(andu+ indu+ endu+endigu) nandi vaahananiddane.

      nanu neenu emba ubhaya heena gunagalanna toredu,
      Jnaani chidananda sukha sampoornaniddane.

      Reply

  317. Posted by Madhavi on October 16, 2012 at 6:21 am

    Hi ,
    Thank u for your prompt reply . Yes , i did downloaded your version of Sri vadirajaru . The one I’ve mentioned is from Jagannatha Dasaru . Its on Kannadaaudio .com sung by Narasimha nayak , wanted the lyrics .
    bye
    Madhavi

    Reply

  318. Posted by Madhavi on October 15, 2012 at 3:31 pm

    hi , Love your site . Looking for Jagannatha dasara Shri lakshmi hrudaya lyrics sung puttur narashimha nayak . As from tomorrow its Dasara festival need to chant the stotra along with narayana varma . can you pls upload it . Thank you

    Reply

  319. Posted by chithra on September 28, 2012 at 9:00 am

    Excellent and very useful site. Can u pls give me the lyrics of Purandaradasa keerthana Narayana Enniro in English and meaning for this song.

    Chithra

    Reply

    • Posted by bhavana on November 13, 2012 at 9:24 am

      nArAyaNa ennirO, shrI narahari pArAyaNa mADirO|
      nArAyaNaneMdu ajamiLanu kaivalya
      sEridaneMbo suddi kELi ariyirA ||

      kAshige hOgalEke, kAvaDi pottu bEsattu tirugalEke
      vAsudEvana nAma bAytuMba nenedare
      klEshagaLeMbudu lEsha mAtravilla ||

      chOrara bhayavillavo, harinAmakke yAra aMkeyillavo
      UranALuva dhore nIti bhItigaLilla
      ghOrapAtakavella dUra mADuvudakke ||

      snAnava mADalEke, mAnavarige mouna maMtragaLEke
      dInapAlaka namma beTTadoDeyana
      dhyAnake sariyuMTe puraMdara viThalana ||

      Reply

  320. Posted by Ranjini on September 22, 2012 at 4:31 am

    please add the lyrics for these two songs……………..
    1) Sevakanelo naanu ninnaya paada seve nedelo neenu by Shri Vaadirajaru
    2) Muniya nodiro mukuti Dhanava bediro by Shri Gopala daasaru
    im not getting these song lyrics anywhere………..
    So,pls pls add the lyrics of these two songs……………..

    Reply

  321. Dear Meera,
    Kindly post the lyrics for the song ‘Hari sarvottama, vaayu jeevottama guru raghavendrarindari manave’.
    Thanks in advance.
    Ram.

    Reply

  322. vaishnav jan to cool stuff where do u get those from though i love ’em

    Reply

  323. Posted by Gopal on September 20, 2012 at 6:01 am

    i am looking for ” Yesthu helali vankatagiriya, shrustige bhahu siriya ” song , madam please give me the lyrics of this song..

    Reply

  324. Posted by Keerthi on September 20, 2012 at 3:13 am

    Sir i need vijayaprada sthothram, which is given to arjuna by Hanuman swami at kurukshethra battlefield

    Reply

  325. Posted by Vasantha on September 19, 2012 at 11:56 pm

    Hi Meera,
    Great work on your site. Here is the lyrics for Bhadrapada Shukladha devotional song by Vijaya Narasimha. He was a genius and awesome kannada song writer. The lyrics lines follows the song by PB Srinivas and S Janaki.

    bhaadhrapadha shukladha chowthiyandhu
    chandhirana nodidhare apavaadha thappadhu
    bhaadhrapadha shukladha chowthiyandhu
    chandhirana nodidhare apavaadha thappadhu
    naraveshadhaari hari krishnanaa ididhu uluvantha nararigu idhu benna bidadhu

    yaadhava kulavanu paavanadholisi udhisidha maadhava madhureyaliee
    yaadhava kulavanu paavanadholisi udhisidha maadhava madhureyaliee
    gollanenisi thana kallanenisidhava govardhana giridhaari
    chowthiya chandrana kaanutha irulali alukidha krishnanu manadhalliee

    raaja rushiyaa sathraajithanige doreyithu anupama dhivya maniee
    thapasige mechhi needidha varavanu karuna mayanaa dhina maniee
    raaja rushiyaa sathraajithanige doreyithu anupama dhivya maniee
    thapasige mechhi needidha varavanu karuna mayanaa dhina maniee

    yaadhavarondhige betege odhanu krishanu kaadinaliee
    simhavu kondhithu ratna dhaariya padeyalu divya maniee

    krishnanobbane hindhake baralu shenkeyu moodithu janaralli
    krishnanobbane hindhake baralu shenkeyu moodithu janaralli
    amoolya maniyanu krishnane kalla yennuva salladha nudi keliee

    krishnanu thaaladhe maniyanu hudukutha horatanu adaviyaliee
    kandanu krishnanu suryana maniyanu karadiya guheyalliee

    jaambavanthana magalu jaambavathi baliyall-iddithu surya maniee
    gora yuddhava maadi koneyanu kaanadhe nindha veeragraniee

    jaambavanthanige ramanaagi sri krishna kandu bandhaa
    jaambavanthanige ramanaagi sri krishna kandu bandhaa
    horaata nedesidha thappigaagi jaambavantha nondhaa
    horaata nedesidha thappigaagi jaambavantha nondhaa

    maniyanithhu magalannu ithhu tha sharanu sharanu yendhaa
    shyamanthaka maniyanu kanda yadhukula hogalithu krishnana olavindhaa

    krishna jaya hari krishna jaya madhava raadha loala jaya
    krishna jaya hari krishna jaya madhava raadha loala jaya

    chowthiya chandrana dharshanadhindha kaadithu krishnana apavaada
    ee kathe kelalu dhorevudu janarige doshada pariharaa
    chowthiya chandrana dharshanadhindha kaadithu krishnana apavaada
    ee kathe kelalu dhorevudu janarige doshada pariharaa

    ganapathi olumege pathraraagalu idhuve sulaba vidhaanaa
    ganapathi olumege pathraraagalu idhuve sulaba vidhaanaa
    karya siddhiya olle buddhiya koduvanu harasutha gajaananaa

    gajaananam bhootha ganaadhi sevitham
    kapittha jamboo phalasaara bhakshitham
    umaa sutham shoka vinaasha kaaranam
    namaami vigneshwara paadha pankajam

    Reply

  326. Here are two of the songs you requested:

    hEge meccisali. rAgA: shankarAbharaNa. tripuTa tALA.

    P: hEge meccisali arcisali ninna nAgashayanana nArada vandyane dEva
    C1: mangaLAbhiSEkake udaka taruvenene gangeyunguSTadi paDediruve
    sangIta kIrtane pADuvenendare tumburu nAradaru pADutiharO dEva
    2: puSpava tandu ninagarpisuvenendare puSpa pallaviside hokkuLali
    ippatettisakOTi dEvargaLadanoppi naivEdya nIDalu trptanAguve
    3: kOTi sUryara prabhe migilAdAtanigondu dIpavanu haccidare beLagahude
    sATi kANade lakSmi ura sthaLavAgire lOSTa kAsu endu kANike nIDelo
    4: hAsigEyanu tandu hAsuvenendare shESana mEle nI pavaDisirpe
    bIsaNigeya tandu bIsuvenendare bIsutihanu khaga tanna pakkadali
    5: nitya guNArNva nija guNa paripUrNa saccidAnanda sanakAdi vandya
    muktidAyaka namma purandara viTTla bhakti dAyakanendu stutisi koNDADuveno

    tirupati vEnkaTaramaNa. rAgA: kharaharapriyA. Adi tALA.

    P: tirupati vEnkaTaramaNa ninagyAtake bAradu karuNa
    A: nambide ninnaya caraNa paripAlisa bEkO karuNa
    C1: aLagiriyindalli banda svAmi anjanagiriyali ninda
    koLalu dhvaniyudO canda namma kuNDalarAya mukunda
    2: bEDeyADuta banda svAmi beTTada mEle ninda
    vITugAra gOvinda alli jEnu sakkareyanu tinda
    3: mUDala giriyali ninda muddu vEnkaTapati balavanta
    Idilla ninage shrIkAnta IrELu lOkakananta
    4: Adidare sthiravappa abhaddagaLADalu oppa
    bEDida varagaLinippa namma mUDalagiri timmappa
    5: appavu atirasa metta svAmi asurara kAlali odda
    satiya kUDADutalidda svAmi sakala durjanaranu gedda
    6: bage bage bhakSya paramAnna nAnA bageya sakala shAlyanna
    bage bage sobagu mOhanna namma nagumukhada suprasanna
    7: kAshi rAmEshvaradinda alli kANike baruvudu canda
    dAsara kUDe gOvinda alli dAri naDevude canda
    8: ellA dEvara gaNDa ava cillare daivada miNDa
    ballidavarige uddaNDa shiva billa murida pracaNDa
    9: kAsu tappidare paTTi baTTi kAsu biDade kaNDu kaTTi
    dAsanendare biDa gaTTi namma kEsakki timmappasetti
    10: dAsara kaNDare prANa tA dhareyoLadhika pravINa
    dvESiya gaNDala kANa namma dEvage nitya kalyANa
    11: mOsa hOguvanallayya ondu kAsige oDDuva kayya
    Esu mahimegAranayya namma vAsudEva timmayya
    12: cittAvadhAna parAku ninna cittada daya ondE sAku
    satyavAhini ninna vAku nInu sakala janarige bEku
    13: allalli pariSeya gumbu mattallalli tOpina tampu
    allalli sogasina sompu mattallalli parimaLadimpu
    14: allalli janagaLa kUDa mattallalli brAhmaNarUTa
    allalli piDida kOlATa mattallalli uRige Ota
    15: pApa vinAshini snAna hari pAdOdakave pAna
    kOpa tApagaLa nidhAna namma purandara viTTalana dhyAna

    Reply

  327. Hi Meera,

    I am looking for the following song lyrics:

    1. Hege mechi saali acchi ninna.. nagashayanane narada vandhyane
    2.Varava kodamma devi saubhagyada varava kodamma thaye
    3.jayathu jaya ganapa ninna dyaanipa..
    4.thirupathi venkata ramana ninage ethaku baaradu karuna.
    5.Mangala maha gouri ranga sahodri gangadarana rani sri gowri
    6.ammana kandira jagadambya kandira durgaya kandira bhadra kaliya kandira

    These were sung by my dodda’s ( granny).. would be grateful
    if any of these i can get 🙂

    U r doing an excellent job!!!!!

    Reply

    • Posted by Nandini on August 2, 2016 at 7:57 am

      hi lekshmy puranik,

      I got the lyrics from my grandma. Happy singing 🙂
      ಮಂಗಳ ಮಹಾಗೌರಿ ರಂಗನ ಸಹೋದರಿ
      ಗಂಗಾಧರನ ರಾಣಿ ಶ್ರೀಗೌರಿ||

      ಮೂತಿನ ಮೂಗುತಿ ಕೊಡೆ
      ರತ್ನದ ವಾಲಿ ಕೊಡೆ
      ಮುತೈದೆ ತನ ಕೊಟ್ಟು ಕಾಪಾಡೆ||

      ವಂಕಿ ಬಳೆ ಕೊಡೆ
      ಕಂಕಣ್ಣ ಋಣಿ ಕೊಡೆ
      ಕುಂಕುಮ ಅರಿಶಿನ ಕೋಟು ಕಾಪಾಡೆ||

      ಪರಿಮಳದ ಪುಷ್ಪ ಕೊಡೆ
      ಜರತಾರಿ ಸೀರೆ ಕುಪ್ಪಸ ಕೊಡೆ
      ತರುಣಿಯರೊಡಗೂಡಿ ಮಾತಾಡೆ||

      ಅನ್ನ ವಸ್ತ್ರವ ಕೊಡೆ
      ಚಿನ್ನದ ಹೊನ್ನು ಕೊಡೆ
      ಸಡಗರ ಸಂಪಾತು ಕೊಟ್ಟು ಕಾಪಾಡೆ||

      Reply

    • Posted by Nandini on August 2, 2016 at 9:28 am

      Youtube link of my grandma singing it, https://youtu.be/tIJ-9Wy3oBQ

      Reply

  328. Can someone transliterate the song, into English, from this link? I tried Baraha but it did not work. Thanks.

    https://meerasubbarao.files.wordpress.com/2009/05/daasanaagu.pdf

    Reply

  329. Posted by neelesh pai on September 17, 2012 at 7:19 am

    |Shri Mukhya Praanantargata Laxmi Venkatesho Vijayate|
    |Shri Rama Deva Veera Vitthala Prasannaha|

    Lyrics By: Shri Jagannathadaasaru

    Nambi Kettavarillavo e gurugala, nambade keduvarunto
    nambida janarige bembala taanagi, hambalisida phala tumbi koduvaranna
    Nambi Kettavarillavo e gurugala, nambade keduvarunto

    Jaladhara dwijavarage, taane olidu sulabha mukutiyanittano.
    Cheluva sutana padeda,lalanege pararinda pulinagartadi divya jalavanitaavaranna
    Nambi Kettavarillavo e gurugala, nambade keduvarunto

    Mrutyu dootaru tannanu pondidanijadhrutyana karedoyyalu
    satta dvijana taanu matte dharege tandu ,mrutyu bidisi sukha ittu porediharanna
    Nambi Kettavarillavo e gurugala, nambade keduvarunto

    Dittaguru jagannath vitthalanolume ghatanavaadudarinda
    Ghatanaghatana kaarya ghatana maaduvo namma patuguruvara hrutpatadiruvoranna
    Nambi Kettavarillavo e gurugala, nambade keduvarunto.

    Reply

  330. Posted by B.K. Vasuki on September 17, 2012 at 12:30 am

    Lyrics of Yesukalangala

    Reply

  331. Posted by Ravindranath on September 16, 2012 at 1:38 am

    Is it possible for you to provide lyrics in English for UDUPI KRISHNA Dasaru Kriti by Sri Vidyabhushana – will be obliged. Thanks. @raviseetha

    Reply

  332. Posted by Varsha Gopi on September 5, 2012 at 5:30 am

    I love this website. I m having a 4 month baby, n was searching for the song “jo jo Shri krishna pramananda”, n here I found all my fav songs. Thank u:-)

    Reply

  333. Posted by Guru on August 28, 2012 at 11:05 pm

    Hello Madam,

    Can u pls post the lyrics of nambi kettavarillavo ee gurugala in kannada?

    Thanks
    Guru

    Reply

  334. तुन्गा तीरदि. रागा: भूपालि.

    फ: तुन्गा तीरदि निन्तसुयतिवर न्यारॆ पॆळम्मा
    आ: सन्गीत प्रिय मन्गळ सुगुण तरग मुनि कुलॊत्तुन्ग काणम्मा
    छ्१: चेलुव सुमुख फणेयल्लि तिलक नामगळु नॊडम्म
    जलज मनुज कोरळल्लि तुलसि मालेगळु पॆळम्म
    सु-ललित कमण्डलु दण्डवन्ने धरिसिहने नॊडम्म
    क्षुल्ल हिरण्यकनल्लि जनिसिद प्रह्लादनु तानिल्लिह नम्म
    २: सुन्दर चरणारविन्दके भकुतियलिन्द नॊडम्म
    वन्दिसि स्तुतिसुव भूसुर व्रिन्द नॊडम्म
    चन्ददलन्क्र्तियिन्द कमन्दिगळ वसदिन्द रहितने
    ३: अभिनव जनार्दन विठलन ध्यानिसुव नॊडम्म
    अभिवन्दिसिवरिगे अखिलथव सल्लिसुव नॊडम्म
    नभमणियन्ददि विविधदि शॊभिसुव नॊडम्म
    शुभ गुणगण निधि राघवॆन्द्र गुरु
    अम्बुज भवाण्डदि प्रवळ काणम्म

    Reply

  335. Posted by Gopal on August 26, 2012 at 11:39 pm

    Madam, i am looking for ” yeshtu helali venkatagiriya srushtige bhahu siriya ” song script please send me if you have,,

    Thanking you
    Gopal

    Reply

  336. I used Baraha to convert to Kannada but I cannot read the script. Some charaters might be incorrect.

    ನೀಲ ಘನ ನೀಲ. ರಾಗಾ: ಆನನ್ದಭೈರವಿ. ತ್/ಆದಿ ತಾಳಾ.

    ೧: ನೀಲ ಘನ ನೀಲ ಜೋ ಜೋ ಕರುಣಾಲವಾಲ ಶ್ರೀ ಕ್ರ್ಶ್ಣ ಜೋ ಜೋ ಲೀಲಾವತಾರ ಜೋ ಜೋ ಪರಮಾತ್ಮ ಬಾಲ ಗೋಪಾಲ ಜೋ ಜೋ
    ೨: ಇನ್ದುಧರ ಮಿತ್ರ ಜೋ ಜೋ ಪರಮಾತ್ಮ ಇನ್ದುರವಿ ನೇತ್ರ ಜೋ ಜೋ ಇನ್ದುಕುಲ ರತ್ನ ಜೋ ಜೋ ಪರಮಾತ್ಮ ಇನ್ದಿರಾರಮಣ ಜೋ ಜೋ
    ೩: ಆಸ್ಚರ್ಯ ಜನಕವಾಗಿ ನಿರ್ಮಿಸಿದ ಪಚ್ಚೆಯಾ ತೊಟ್ಟಿಲಲ್ಲಿ ಅಚ್ಯುತಾನನ್ತನಿರಲು ತೂಗಿದರು ಮತ್ಸ್ಯಾವತಾರ ಹರಿಯ
    ೪: ಧರ್ಮ ಸಮ್ಸ್ಥಾಪನೆನ್ದು ನಿರವಧಿಕ ನಿರ್ಮಲಾಚರಿತನೆನ್ದು ವರ್ಮ ಕರ್ಮಗಳ ತಿಳಿದು ತೂಗಿದರು ಕೂರ್ಮಾವತಾರ ಹರಿಯ
    ೫: ಸರಸಿಜಾಕ್ಶಿಯರೆಲ್ಲ ಜನವಶ್ಯ ಕರ ದಿವ್ಯ ರೂಪನೆನ್ದು ಪರಮ ಹರ್ಶದಿ ಪಾಡುತ ತೂಗಿದರು ವರಹಾವತಾರ ಹರಿಯ
    ೬: ಕರಿಕುಮ್ಭಗಳು ಪೋಲುವ ಕುಚದಮೇಲ್ ಹಾರ ಪದಕವು ಹೊಳೆಯಲು ವರ ವರ್ಣಿನಿಯರು ಕೂಡಿ ತೂಗಿದರು ನರಸಿಮ್ಹ ರೂಪ ಹರಿಯ
    ೭: ಭಾಮಾ ಮಣಿಯರು ಎಲ್ಲ ಜಗದೊಳಗೆ ಸೋಮನಿವನೆನ್ದು ಹೊಗಳಿ ನೇಮ ದಿನ್ದಲಿ ಪಾಡುತ ತೂಗಿದರು ವಾಮನ ರೂಪ ಹರಿಯ
    ೮: ಸಾಮಜ ವರದನೆನ್ದು ಅತುಳ ಭ್ರುಗು ರಾಮಾವತಾರನೆನ್ದು ಪ್ರೇಮದಿನ್ದಲಿ ಪಾಡುತ ತೂಗಿದರು ಭಾರ್ಗವ ರೂಪ ಹರಿಯ
    ೯: ಕಾಮಿನಿಯ ಕಾಮನೆನ್ದು ಸುರಸಾರ್ವಭೌಮ ಗುಣಧಾಮನೆನ್ದು ವಾಮ ನೇತ್ರಿಯರು ಪಾಡಿ ತೂಗಿದರು ರಾಮಾವತಾರ ಹರಿಯ
    ೧೦: ಸ್ರುಶ್ಟಿಯಾ ಕರ್ತನೆನ್ದು ಜಗದೊಳಗೆ ದುಶ್ಟ ಸಮ್ಹಾರನೆನ್ದು ದ್ರುಶ್ಟಾನ್ತ ರಹಿತನೆನ್ದು ತೂಗಿದರು, ಕ್ರ್ಷ್ಣಾವತಾರ ಹರಿಯ
    ೧೧: ವ್ರುದ್ಧ ನಾರಿಯರು ಯೆಲ್ಲ ಜಗದೋಳ್ ಪ್ರಸಿದ್ಧನಿವನೆನ್ದು ಹೊಗಳಿ ಬದ್ಧಾನುರಾಗದಿನ್ದ ತೂಗಿದರು ಬೌದ್ಧಾವತಾರ ಹರಿಯ
    ೧೨: ಝಣ ಝಣತ್ಕಾರದಿನ್ದ ರನ್ಜಿಸುವ ಮಲಯಜಾಲೇಪದಿನ್ದು ಕುಸುಮ ಗನ್ಧಿಯರು ಕೂಡಿ ತೂಗಿದರು ಕಲ್ಕ್ಯಾವತಾರ ಹರಿಯ
    ೧೩: ತುನ್ಗ ಭವ ಭನ್ಗ ಜೋ ಜೋ ಶ್ರೀ ಕ್ರ್ಶ್ಣ ಮನ್ಗಳಾಪಾನ್ಗ ಜೋ ಜೋ ರನ್ಗ ಶ್ರೀ ಪಾನ್ಗ ಜೋ ಜೋ ಪರಮಾತ್ಮ ರನ್ಗವಿಟ್ಠಲನೆ ಜೋ ಜೋ

    Reply

  337. Posted by Anand M R on August 17, 2012 at 10:47 am

    Hi Sri Lakshman, Thanks a lot for giving the lysrics of this song. I really like this song. IS this available in Kannada. It will help my my mother who can read kannada. Thanks again for your effort in providing the lyrics of this song.

    With warm regards
    Anand

    Reply

  338. lAli by Shripadaraya.

    niila ghana niila jO jO, kuruNaalavaala shrii kriShNa jO jO
    liilaavataara jO jO, paramaatma baala gOpaala jO jO

    indudhara mitra jO jO, paramaatma, induravi nEtra jO jO
    indukula ratna jO jO, paramaatma, indiraa ramaNa jO jO

    aascharya janakavaagi, nirmisida, paccheyaa toTTilalli
    achyutaanantaniralu, tuugidaru, matsyaavataara hariya

    dharma samsthaapanendu, niravadhika, nirmalaacharitanendu
    varma karmagaLa tiLidu, tuugidaru, kuurmaavataara hariya

    sarasijaakShiyaru ella, janavashya kara divya ruupanendu
    parama harShadi paaDuta, tuugidaru varahaavataara hariya

    karkumbhagaLu pOluva kuchadamEl haara padakavu hoLeyalu
    vara varNiniyaru kuuDi tuugidaru, narasimha ruupa hariya

    bhaamaa maNiyarella, jagadoLage sOmanivanendu hogaLi
    nEma dindali paaDuta tuugidaru, vaamana ruupa hariya

    saamaja varadanendu atuLa bhr^ugu raamaavataaranendu
    prEmadindali paaDuta tuugidaru, bhaargava ruupa hariya

    kaaminiya kaamanendu, surasaarvabhouma guNadhaamanendu
    vaama nEtriyaru paaDi tuugidaru, raamaavataara hariya

    sr^uShTiyaa kartanendu jagadoLage duShTa samhaaranendu
    dr^uShTaanta rahitanendu tuugidaru, kriShNaavataara hariya

    vr^uddha naariyaru yella jagadOL prasiddhanivanendu hogaLi
    baddhaanuraagadinda tuugidaru, bouddhaavataara hariya

    jhaNa jhaNatkaaradinda ranjisuva malayajaalEpadindu
    kusuma gandhiyaru kuuDi tuugidaru, kalkyaavataara hariya

    tunga bhava bhanga jO jO, shrii kriShNa, mangaLaaapaanga jO jO,
    ranga shrii paanga jO jO, paramaatma ranga-viTThalane jO jO

    Reply

  339. hi i wanted some gud lakshmi songs in kannda with lyrics plz help me …n guru ragavendra kannada bakthigeethe with lyrics i wanted to listen plz do help me n mail me…..

    Reply

  340. A wonderful all-in-one site for anyone who wants to feed his immortal “atma” in addition to just feeding his mortal ‘sharira’ in this most rarest and precious ‘manava janma……JAYATEERTH KOTY, from Nagarabhavi, Bangalore( presently at Santa Clara, CA)

    Reply

  341. Posted by Anand M R on August 16, 2012 at 12:05 am

    Dear Meera,

    Your hard work in consolidting & collating all the jewels of Devotional literature is highly appreciated. My mother was singing 2 laali songs for krishna. SHe has forgot the lyrics now and remembers only few lines. If you have it please share the lyrics for the following.
    1. The song has laali for all 10 avataras and starts like “Neelagana leela Jo Jo, balkrishna jo jo..and some lines like “Ananda sadhana dolagey nirmisdha pacheya totillalli”……and so on….and has ending of each para like “toogidharu Krishnavatra Hariya”, or “Toogidharu Ramavathra Haria ya and so on”…

    2. Laali for Krishna….. “Rohini nakshtarta shuba lagna dhalli”…and end each para.. “Thaai devaki bandhu toogidhru hariyaa laali”…it has one line as “Laali Ranga Vittala”.. so I asume that it is Sri. Vyasaraja’s work.

    Sorry if the description is very vague. Thanks in advance for your help.

    Regards
    Anand

    Reply

    • ನೀಲ ಘನ ನೀಲ ಜೋ ಜೋ
      ಕರುಣಾಲವಾಲ ಶ್ರೀ ಕೃಷ್ಣ ಜೋ ಜೋ
      ಲೀಲಾವತಾರ ಜೋ ಜೋ
      ಪರಮಾತ್ಮ ಬಾಲ ಗೋಪಾಲ ಜೋ ಜೋ ||೧||

      ಇಂದುಧರ ಮಿತ್ರ ಜೋ ಜೋ
      ಪರಮಾತ್ಮ ಇಂದುರವಿ ನೇತ್ರ ಜೋ ಜೋ
      ಇಂದುಕುಲ ರತ್ನ ಜೋ ಜೋ
      ಪರಮಾತ್ಮ ಇಂದಿರಾರಮಣ ಜೋ ಜೋ ||೨||

      ಆಶ್ಚರ್ಯ ಜನಕವಾಗಿ ನಿರ್ಮಿಸಿದ
      ಪಚ್ಚೆಯಾ ತೊಟ್ಟಿಲಲ್ಲಿ ಅಚ್ಯುತಾನಂತನಿರಲು
      ತೂಗಿದರು ಮತ್ಸ್ಯಾವತಾರ ಹರಿಯ ||೩||

      ಧರ್ಮ ಸಂಸ್ಥಾಪನೆಂದು
      ನಿರವಧಿಕ ನಿರ್ಮಲಾಚರಿತನೆಂದು
      ವರ್ಮ ಕರ್ಮಗಳ ತಿಳಿದು
      ತೂಗಿದರು ಕೂರ್ಮಾವತಾರ ಹರಿಯ ||೪||

      ಸರಸಿಜಾಕ್ಷಿಯರೆಲ್ಲ ಜನವಶ್ಯ
      ಕರ ದಿವ್ಯ ರೂಪನೆಂದು
      ಪರಮ ಹರುಷದಿ ಪಾಡುತ
      ತೂಗಿದರು ವರಹಾವತಾರ ಹರಿಯ ||೫||

      ಕರಿಕುಂಭಗಳು ಪೋಲುವ
      ಕುಚದಮೇಲ್ ಹಾರ ಪದಕವು ಹೊಳೆಯಲು
      ವರ ವರ್ಣಿನಿಯರು ಕೂಡಿ
      ತೂಗಿದರು ನರಸಿಂಹ ರೂಪ ಹರಿಯ ||೬||

      ಭಾಮಾ ಮಣಿಯರು ಎಲ್ಲ
      ಜಗದೊಳಗೆ ಸೋಮನಿವನೆಂದು
      ಹೊಗಳಿ ನೇಮದಿಂದಲಿ ಪಾಡುತ
      ತೂಗಿದರು ವಾಮನ ರೂಪ ಹರಿಯ ||೭||

      ಸಾಮಜ ವರದನೆಂದು
      ಅತುಳ ಭೃಗು ರಾಮಾವತಾರನೆಂದು
      ಪ್ರೇಮದಿಂದಲಿ ಪಾಡುತ
      ತೂಗಿದರು ಭಾರ್ಗವ ರೂಪ ಹರಿಯ ||೮||

      ಕಾಮಿನಿಯ ಕಾಮನೆಂದು
      ಸುರಸಾರ್ವಭೌಮ ಗುಣಧಾಮನೆಂದು
      ವಾಮ ನೇತ್ರಿಯರು ಪಾಡಿ
      ತೂಗಿದರು ರಾಮಾವತಾರ ಹರಿಯ ||೯||

      ಸೃಷ್ಟಿಯಾ ಕರ್ತನೆಂದು
      ಜಗದೊಳಗೆ ದುಷ್ಟ ಸಂಹಾರನೆಂದು
      ದ್ರುಷ್ಟಾಂತ ರಹಿತನೆಂದು
      ತೂಗಿದರು ಕೃಷ್ಣಾವತಾರ ಹರಿಯ ||೧೦||

      ವೃದ್ಧ ನಾರಿಯರು ಎಲ್ಲ ಜಗದೋಳ್
      ಪ್ರಸಿದ್ಧನಿವನೆಂದು ಹೊಗಳಿ
      ಬದ್ಧಾನುರಾಗದಿಂದ
      ತೂಗಿದರು ಬೌದ್ಧಾವತಾರ ಹರಿಯ ||೧೧||

      ಝಣ ಝಣತ್ಕಾರದಿಂದ ರಂಜಿಸುವ
      ಮಲಯಜಾಲೇಪದಿಂದು
      ಕುಸುಮ ಗಂಧಿಯರು ಕೂಡಿ
      ತೂಗಿದರು ಕಲ್ಕ್ಯಾವತಾರ ಹರಿಯ ||೧೨||

      ತುಂಗ ಭವಭಂಗ ಜೋ ಜೋ
      ಶ್ರೀ ಕೃಷ್ಣ ಮಂಗಳಾಪಾಂಗ ಜೋ ಜೋ
      ರಂಗ ಶ್ರೀಪಾಂಗ ಜೋ ಜೋ
      ಪರಮಾತ್ಮ ರಂಗವಿಠ್ಠಲನೆ ಜೋ ಜೋ ||೧೩||

      Reply

  342. Posted by sudheendra on August 11, 2012 at 6:30 am

    hi, I am Sudheendra, I m searching for the lyrics of the song”byasarade bhajisiro purandara dasa rayara,,,,, shersha nimmanu udasina madade poshisuva santoshadindali………… pls provide me the lyrics of this song…………

    Reply

  343. Posted by Veena Maniraj on August 9, 2012 at 3:14 am

    Hi Team,

    Can you please provide me the lyrics of the song panduranga twatpada palisiya in engish.

    Thanks
    Veena Maniraj

    Reply

  344. Posted by bhavana on August 8, 2012 at 9:18 am

    Dear Meera,

    I am in search of a kannada devotional song – sung by S. Janaki? Vani Jayaram? –

    I had heard this song during 1983 – 1988. I don’t know whether it was from a movie(kannada) or from devotional music cassette.
    I do not remember whether it starts with a shloka.
    I remember about 60% sahitya of the song and some lines are missing.
    Anyway i will write here whatever i remember and it may give you some clue.

    O mAte Srilalite SAradeye Shringagiri iLidu bA tAyi siridEvi
    sirigannadAmbe nee harasamma tAye ||

    jnAnAdhidEvate (p)ratirUpa mahAmAte rasakAvyarannara makutamNiye
    pampAdidAsara padajyothi neenamma gaganada siriyamma ee ninna gAmbheerya
    ninna nAmave bhakti jnAnasAdhana shakti
    Saranembe namisuve SAradamAte ||

    …………………………………………………………..
    ……………………………………………………………
    ……………………………………………………………….
    …………………………………………………………….
    sangeetharasike karapadmabhUshini
    swararAga tAlalaya shrutigAna tumbutali

    (……………….swaras……………….)

    ninna namave janani tungAnadi teertha
    nudisamma harasamma SAradamAte ||

    I need the lyrics as well as mp3 or video of the song.

    WITH REGARDS,
    – Bhavana.

    Reply

    • Posted by meeraghu on August 8, 2012 at 9:20 am

      Did you try searching Kannadaaudio? I am not aware of this song, if I find the lyrics I will definitely post it here.

      Reply

      • Posted by bhavana on August 10, 2012 at 12:05 pm

        I didn’t get it in kannada audio. The main problem is I do not know whether it is from a movie or from devotional music cassette and I do not remember whether it starts with a shloka.
        I can sing the available lyrics but it is incomplete because of a few missing lines.

        I am searching an other song also. It is a bhavageethe.-

        Hareyada hasiranu chimmutha niriyolu
        shravana sundari bandaliga

    • Posted by Varsha on July 8, 2016 at 2:14 am

      I could fill in the swaras:
      Sa sa ni da ni da sa ni da pa ma ga ri ga ga,
      Ri ga ga ga ri ri ga ri ma sa ri ni ri sa sa
      Ni sa ni da ni ni sa da ni ma da ga ma
      Sa ga ri ma ga da ma ni da sa ni ri sa sa

      Reply

  345. suuper fantastic thanks

    Reply

  346. Hello Meera mam,
    Need your help to upload lyrics of Sampat Shukravarada Haadu. Earlier it was there in your website but now I am unable to find. Please help, my email ID is ram19732003@gmail.com, also need help if you can send us the audio song.

    Reply

  347. Posted by Ranjini on July 19, 2012 at 4:03 pm

    Hi Meera,

    I just got your website when I was searching for Sampath Shukruvara hadu ..this website is helpfull. Thank you

    Can you please upload the lyrics for ” Bandu nelesau Indire yennaya Mandiradolaganandadi”

    Reply

  348. Hello madam,
    I felt very happy when i have seen your posts. Please do add some more lyrics.
    hopefully you do ASAP.

    Reply

  349. Posted by veena raghavendra on July 4, 2012 at 2:41 am

    can I get lyrics for variraja virachita “Govinda Gopala Gopika Vallabha”

    Reply

    • gOvinda gOpAla gOpikA. rAgA: tODi. tripuTa tALA.

      P: gOvinda gOpAla gOpikA vallabha
      C1: gOvardhanOddhAraka gOvardhanOddhAraka
      nArAyaNa acyuta nara mriga rUpa shrIpati shauri hari
      varijOdbhava vandya vandita caritra
      puramArdana mitra parama pavitra
      2: ina sashi lOcana indu nibhAnana yenuta kuNDala nAthana
      kanakamaya vAsana ghanapApa nAshana
      yenuta kuNDala nAtha vENunatha hayavadana

      Reply

  350. Posted by mamos.bharathi on June 29, 2012 at 10:39 am

    Hello Hemamalini,
    If you are any one that can help you, the tamil version varahi ashtakam( or anything) is easy to do by yourself.

    Here is how you can do. Go to google.com and click on menu MORE arrow down, select tamil. Start typing it will automatically give you tamil version.
    Bharathi

    Reply

  351. Posted by hemamalini on June 27, 2012 at 10:07 am

    Mam
    I want a tamil version of varahi ashtakam Eng version is very difficult for m e to pronounce the correct sound
    regards
    Hema

    Reply

  352. Posted by mamos.bharathi on June 18, 2012 at 11:15 pm

    Hello Sri Raghavendra Rao,

    There is a person P.R.Ramachander though a Tamilian but like you lived in Bangalore all along
    He has a web site where he has so many songs of purandara dasa with English meaning. He has other great materials as well please take a look it might help
    Here is a link:
    http://www.celextel.org/carnaticmusickrithis/purandaradasa/

    Regards
    Bharathi

    Reply

  353. Posted by T.Raghavendra Rao, Pensioner, H No.16-2-752/21/7, Triveni nagar, Gaddiannaram, Hyderabad-500060 Andhra Pradesh on June 18, 2012 at 10:07 am

    Hi Meera,
    I am retired person. I found the blog very useful to know the lyrics to many dasara padas and devotional songs.
    Will you please help me to have a link to know meanings to Kannada lyrics into Telugu. Though we are Madhwas quite settled in Andhra Pradesh and have little knowledge of Kannada. Telugu/English meaning to Dasara Padas will really help our family members to understand the meaning while doing bhajan.

    Reply

    • Posted by meeraghu on June 18, 2012 at 7:22 pm

      I understand, however I am not sure how I can help, since I don’t know or understand Telugu.

      Reply

  354. Posted by padma on June 17, 2012 at 3:31 am

    I would like to have the lyrics for the song kamala kamalanana mukha divija sumukha padayugalam by Sri vidhya prasanna thirtharu

    Reply

  355. Posted by lalitha on June 13, 2012 at 10:31 am

    I like this site very much and I took the print out of Mahishasura mardini slokam
    My name is lalitha Raja. Does any one know the lyrics of kanyaka parameshwari stotram in tamil. If so, please post it. Thanks.

    Reply

  356. Posted by Guru Prasad on June 5, 2012 at 1:09 am

    Please help me download “” raghavendra guru rayara sevisiro”” song mp3

    Reply

  357. Posted by amma/bharathi on June 4, 2012 at 4:43 pm

    kannda version of Sangeetha saamrajya

    ಹಾಡು: ಸಂಗೀತ ಸಾಮ್ರಾಜ್ಯ
    ರಾಗ : ಮೋಹನಕಲ್ಯಾಣಿ
    ತಾಳ : ಆದಿ
    ರಚನೆ : ಬೆಂಗಳೂರು ರಾಮಮೂರ್ತಿ

    ಪಲ್ಲವಿ
    ಸಂಗೀತ ಸಾಮ್ರಾಜ್ಯ ಸಂಚಾರಿಣಿ
    ಶೃಂಗಾರ ಶ್ರಿಂಗೇರಿ ಪುರ ವಾಸಿನಿ
    ಅನುಪಲ್ಲವಿ
    ಉನ್ನತ ಪಾಂಡ್ಯ ಕೇರಳ ವಾಸಿನಿ
    ಸನ್ನುತ ಶ್ರೀ ಚಕ್ರ ಮಧ್ಯ ನಿವಾಸಿನಿ
    ಕಾಲಡಿ ಶಂಕರ ಹ್ರದಯ ನಿವಾಸಿನಿ
    ಕಾಲ ಪಾಲಕ ಬ್ರಹ್ಮ ವಿಶ್ವಾಸಿನಿ
    ಚರಣ
    ಗಾಂಧಾರ ಪಂಚಮ ದೈವತ ರೂಪಿಣಿ
    ನಿಷಾದ ಮಧ್ಯಮ ಸಪ್ತ ಸ್ವರೂಪಿಣಿ
    ಮಂದರ ಕುಸುಮ ಮಣಿಮಯ ತೇಜೋ
    ಮಾಧುರ್ಯ ಮೋಹನಕಲ್ಯಾಣಿ ಸ್ವರೂಪಿಣಿ
    ಚಿಟ್ಟೆ ಸ್ವರ
    ಸ (ನಿ )(ದ )ಸ ,ರಿಗ , ,ದ ಪ ಮ ಗ ರಿ ಸ (ನಿ ) | (ದ )ಸ ರಿ ಗ ,ಪ ದ , ,ಸ ”ನಿ ದ ಪ ಮ ಗ ರಿ ||
    ಗ ಪ ಮ ಗ ,,ಪ ಮ ಗ ಸ ”ನಿ ದ ,,ಸ ”ನಿ | ದ ಗ ”ರಿ ”ಸ ” ,ಪ ದ ರಿ ” ಸ ”ನಿ ದ ಪ ಮ ಗ ಸ ರಿ ||
    ,ಗ ,ಪ ದ ,ಗ ದ ,ರಿ ಗ , ಪ ,ದ ಸ ” | ,,ದ ರಿ ” ,ಪ ದ ಸ ” ,ರಿ ”ಗ ”, ರಿ ”ಗ ”,ಗ ” ||
    ರಿ ”ಗ ”ಸ ”, ನಿ ದ ,ದ ಪ ದ ಪ , ಮ ಗ ,ಗ | ರಿ ಗ ಸ , (ನಿ )(ದ ),ಗ ” ರಿ ”ಸ ”ನಿ ದ ಪ ಮ ಗ ರಿ ||
    ಕೆಳ ಸ್ಥಾಯಿ ಸ್ವರ () ಗಳಲ್ಲಿದೆ . ಹೆಚ್ಚು ಸ್ಥಾಯಿ ಸ್ವರ “ ಗಳಲ್ಲಿದೆ

    Reply

  358. Posted by bharathi on June 4, 2012 at 9:38 am

    Thank you so much.

    I am going to request my daughter’s dance teacher to teach her a dance for this song.

    Bharathi.

    Reply

  359. Posted by bharathi on May 31, 2012 at 11:39 am

    Hello,

    Does anyone have the lyrics for Shringa Puradeeshwari Sharade?

    Thank you,

    Bharathi.

    Reply

    • Posted by amma/bharathi on June 4, 2012 at 4:18 am

      Song: shRNga purAdIshwari
      Ragam: kalyANI
      Thalam: Adi
      Composer: Padmacharan

      Pallavi

      shRNgapurAdIshwari shAradE
      shubha maNgalE sarvAbhIshta pradE

      Anupallavi

      shaNkara sannuta srI padma charagE
      sakala kalAdi shAradE varadE
      sadanenna thAyE sAmagAna priyE

      Charanam

      karuNi semma sruti gatigaLa mAtE
      kamanIya sapta swarasupUjitE
      sAmagAna kalA swarUpiNi
      kAmita dAyini kalyANi janani

      ಪಲ್ಲವಿ
      ಶೃಂಗ ಪುರಾ ದೀಶ್ವರಿ ಶಾರದೆ
      ಶುಭ ಮಂಗಳೇ ಸರ್ವಭಿಷ್ಟ ಪ್ರದೇ

      ಅನುಪಲ್ಲವಿ

      ಶಂಕರ ಸನ್ನುತ ಶ್ರೀ ಪದ್ಮ ಚರಗೆ
      ಸಕಲ ಕಾಲಡಿ ಶಾರದೆ ವರದೇ
      ಸದನೆನ್ನ ತಾಯೇ ಸಾಮಗಾನ ಪ್ರಿಯೆ

      ಚರಣ

      ಕರುಣಿ ಸೆಮ್ಮ ಶ್ರುತಿ ಗತಿಗಳ ಮಾತೆ
      ಕಮನೀಯ ಸಪ್ತ ಸ್ವರಸುಪೂಜಿತೆ
      ಸಾಮಗಾನ ಕಲಾ ಸ್ವರೂಪಿಣಿ
      ಕಾಮಿತ ದಾಯಿನಿ ಕಲ್ಯಾಣಿ ಜನನಿ

      Anothr song you might be interested in

      Song: sangIta sAmrAjya
      Ragam: mOhanakalyANI
      Thalam: Adi
      Composer: Bangalore Ramamurti

      Pallavi

      sangIta sAmrAjya sancAriNi
      shrngAra shrngEripura vAsini

      Anupallavi

      unnata pANDya kEraLa vAsini
      sannutashrI cakra madhya nivAsini
      kAlaDi shankara hrdaya nivAsini
      kAla pAlaka brahma vishvAsini

      Charanam

      gAndhAra pancama dhaivata rUpiNi
      niSAda madhyama sapta svarUpiNi
      mandAra kusum maNimaya tEjO
      mAdhurya mOhanakalyANi svarUpiNi

      Chittai Swaram

      S(N)(D)S ,RG, ,DPM GRS(N) | (D)SRG ,PD, ,S”ND PMGR ||
      GPMG ,,PM GS”ND ,,S”N | DG”R”S” ,PDR” S”NDP MGSR ||
      ,G,P D,GD ,RG, P,DS” | ,,DR” ,PDS” ,R”G”, R”G”,G” ||
      R”G”S”, ND,D PDP, MG,G | RGS, (N)(D),G” R”S”ND PMGR ||

      (lower octave swarams denoted by (), high octave denoted by “)

      Thank all bharathi

      Reply

  360. ರಾಗ : ಮೋಹನ

    ಬಾರೇ ಭಾಗ್ಯದ ನಿಧಿಯೆ ಕರವೀರ ನಿವಾಸಿನಿ ಸಿರಿಯೇ|
    ಬಾರೆ ಬಾರೆ ಕರವೀರ ನಿವಾಸಿನಿ ಬಾರಿ ಬಾರಿಗು ಶುಭ ತೋರೆ ನಮ್ಮನಿಗೆ ||

    ನಿಗಮ ವೇದ್ಯಳೆ ನೀನು ನಿನ್ನ ಪೊಗಳಲಾಪನೆ ನಾನು|
    ಮಗನಪರಾಧವ ಕಡೆಗಣಿಸದಲೆ ಪನ್ನಗವೇಣಿಯೆ ಲಗುಬಗೆಯಿಂದಲಿ ||

    ಲೋಕಮಾತೆಯು ನೀನು ನಿನ್ನ ತೋಕನಲ್ಲವೆ ನಾನು|
    ಆಕಳ ಕರುವಿನ ಸ್ವೀಕರಿಸುವ ಪರಿ ನೀ ಕರುಣದಿ ಕಾಲ್ಹಾಕು ನಮ್ಮನಿಗೆ ||

    ಕಡೆಗೇ ನಮ್ಮನಿವಾಸ ಒಡೆಯನಂತಾಧೀಶ|
    ಒಡೆಯನಿದ್ದಲ್ಲಿಗೆ ಮಡದಿ ಬಾಹುದೇ ರೂಢಿಗುಚಿತವಿದು ನಡಿ ನಮ್ಮನಿಗೇ ||

    ಶ್ರೀ ಅನಂತಾದ್ರೀಶರ ರಚನೆ
    ———

    Reply

  361. Posted by amma on May 26, 2012 at 3:03 pm

    Thank you.
    I was referring to some ones posting of the song request “Jo Jo Yashodaye Nanda Mukundane” which is in the “Thoogire …” album ( and not the song thoogire.. itself)
    Thanks again for providing this also
    Bharathi

    Reply

  362. Posted by Chitra on May 25, 2012 at 4:13 pm

    The lyrics in English.

    Toogeere Rangana toogeere Krishnana toogeere Achyutananthana
    Toogeere Varagiriyappa Thimappana toogeere Kaveri Rangayyana

    Nagalokadalli Narayana Malagyane
    Naagakannikeyaru toogeere
    Nagaveniyaru Nenu Pididhukondu
    begane tottila toogeere

    Indra Lokadalli Upendra malagyane
    Indu Mukiyarella toogeere
    Indra Kannikeyaru chandadhi bandhu
    Mukundana tottila toogeere

    Aaladeleya mele ShriLola malagyane
    Neela Kunthaleyaru toogeere
    Vyala Shayana Hari malagu malagu endhu
    BalaKrishnayyana toogeere

    Saasira Naamane Sarvothamanendhu
    Soosutha tottila toogeere
    Lesaagi maduvinol Sheshana tulidhitta
    Dosha Vidhoorana toogeere

    Aralele Maagaayi korala muthinahaara
    Taralana tottila toogeere
    SiriDevi Ramanane Purandara Vittalane
    Karunadhi malagendhu toogeere

    Reply

  363. Posted by Chitra on May 25, 2012 at 4:10 pm

    The lyrics to the song in Kannada.

    ತೂಗಿರೆ ರಂಗನ ತೂಗಿರೆ ಕೃಷ್ಣನ ತೂಗಿರೆ ಅಚ್ಯುತಾನoತನ
    ತೂಗಿರೆ ವರಗಿರಿಯಪ್ಪ ತಿಮ್ಮಪ್ಪನ ತೂಗಿರೆ ಕಾವೇರಿ ರಂಗಯ್ಯನ

    ನಾಗಲೋಕದಲ್ಲಿ ನಾರಾಯಣ ಮಲಗ್ಯಾನೆ
    ನಾಗಕನ್ನಿಕೆಯರು ತೂಗಿರೇ
    ನಾಗವೇಣಿಯರು ನೇಣು ಪಿಡಿದುಕೊಂಡು
    ಬೇಗನೆ ತೊಟ್ಟಿಲ ತೂಗಿರೇ

    ಇಂದ್ರಲೋಕದಲ್ಲಿ ಉಪೇಂದ್ರ ಮಲಗ್ಯಾನೆ
    ಇಂದು ಮುಖಿಯರೆಲ್ಲಾ ತೂಗಿರೇ
    ಇಂದ್ರ ಕನ್ನಿಕೆಯರು ಚಂದದಿ ಬಂದು
    ಮುಕುಂದನ ತೊಟ್ಟಿಲ ತೂಗಿರೇ

    ಆಲದೆಲೆಯ ಮೇಲೆ ಶ್ರೀಲೋಲ ಮಲಗ್ಯಾನೆ
    ನೀಲ ಕುಂತಳೆಯರು ತೂಗಿರೇ
    ವ್ಯಾಳ ಶಯನ ಹರಿ ಮಲಗು ಮಲಗು ಎಂದು
    ಬಾಲಕೃಷ್ಣ ಯ್ಯನ ತೂಗಿರೇ

    ಸಾಸಿರ ನಾಮನೆ ಸರ್ವೋತ್ತಮನೆಂದು
    ಸೂಸುತ್ತ ತೊಟ್ಟಿಲ ತೂಗಿರೇ
    ಲೇಸಾಗಿ ಮಡುವಿನೋಳ್ ಶೇಷನ ತುಳಿದಿಟ್ಟ
    ದೋಷ ವಿದೂರನ ತೂಗಿರೇ

    ಅರಳೆಲೆ ಮಾಗಾಯಿ ಕೊರಳ ಮುತ್ತಿನ ಹಾರ
    ತರಳನ ತೊಟ್ಟಿಲ ತೂಗಿರೇ
    ಸಿರಿದೇವಿ ರಮಣನೆ ಪುರಂದರ ವಿಠಲನೆ
    ಕರುಣದಿ ಮಲಗೆಂದು ತೂಗಿರೆ

    Reply

  364. Posted by amma on May 24, 2012 at 11:06 pm

    This song is in the album
    “Thoogire Rangana Thoogire Krishna” by Ratnamala Prakash
    http://www.raaga.com/channels/kannada/moviedetail.asp?mid=kd00260

    I have not found it in any book. Need to write it down by listening.
    Bharathi

    Reply

  365. Posted by kiran on May 17, 2012 at 1:16 am

    i want the lyrics of pandrapuravembha puttanagara alli vittobha enuva

    Reply

    • Posted by Prasanna L on May 21, 2012 at 9:51 am

      Hi Meera,

      Can you please share the lyrics of “Jo Jo Yashodaye Nanda Mukundane” by Purandaradasaru?

      Thanks,
      Prasanna L

      Reply

      • Posted by amma on May 30, 2012 at 9:37 pm

        To all of you,

        Here is the song Jo Jo Yashodeya nanda.
        The lyrics is so nice can’t get over it
        It is sung so nicely.
        Enjoy
        Bharathi

        ಜೋ ಜೋ ಯಶೋದೆಯ ನಂದ ಮುಕುಂದನೇ
        ಜೋ ಜೋ ಕಂಸ ಕೊಠಾರೀ
        ಜೋ ಜೋ ಮುನಿಗಳ ಹೃದಯ ಮಂದಿರ
        ಜೋ ಜೋ ಲಕುಮಿಯ ರಮಣ

        ೧) ಹೊಕ್ಕಳ ಭೂಮಿಯ ತಾವರೆ ಗಣಿ್ಣನ
        ಇಕ್ಕಿಟ್ಟ ಮಕರ ಕುಂಡಲದ ಜ್ಹಕ್ಕರೆ ಸುವಕದ
        ದಿನತೋಳಿ ಕುರುವಿನ ಚಿಕ್ಕ ಬಾಯಿ ಮುದ್ದುಮೊಗದ
        ಸೊಕ್ಕಿದ ಮದದರಿ ಯಂದದಿ ನೊಸಳಲಿ ಇಕ್ಕಿದ ಕಸ್ತೂರಿಯ ತಿಲಕ
        ರಕ್ಕಸ ನೆದೆ ತಲ್ಲಣ ಮುರವೈರಿ ಮಕ್ಕಳ ಮಾಣಿಕ್ಯ

        ೨) ಕಣ್ಣಾ ಬೆಳಗು ಪಸರಿಸಿ ನೋಡುತ ಹೊರೆಗಣ್ಣ ಮುಚ್ಚಿ ನಸುನಗುತ
        ಸಣ್ಣ ಬೆರಳು ಬಾಯೊಳು ಹೊಳೆಯುತ್ತ ಪನ್ನಗ ಶಯನ ನಾಟಕನೆ
        ನಿನ್ನ ಮಗನ ಮತ್ತೆ ನೋಡೆನುತ ಗೋಪಿ ತನ್ನ ಪತಿಗೆ ತೋರಿದಳು
        ಚಿನ್ನ ತನದ ಸೊಬಗಿನ ತಳಿಯೇ ಹೊಸರನ್ನ ಮುತ್ತಿನ ಬೊಂಬೆ

        ೩) ಬಿಡಿ ಕಾಲ್ಗಳ ಪಸರಿಸುತಲಿ ಗೋಪಿಯ
        ತೊಡೆಯ ಮೇಲೆ ಮಲಗಿ ಬಾಯಿ ತೆರೆಯೆ
        ಒಡಲೊಳು ಚತುರ್ದಶ ಭುವನ ಇರಲು ಕಂಡು
        ನಡುನಡುಗಿ ಕಣ್ಣ ಮುಚ್ಚಿದಳು
        ತಡೆಯದೆ ಅಡಿಗಳ ನಿಡುತಲಿ ಬಂದು ಮದದೆರ ಮುಖವ ನೋಡುತ ನಿಂತು
        ಕಾಡುದಾಯ ಸೋದರ ಪುರಂದರ ವಿಠ್ಠಲ ಬಿಡದೆ ರಕ್ಷಿಸು ಎನ್ನ ಸಲಹ ಬೇಕೆಂದು

  366. Posted by kiran on May 16, 2012 at 3:43 am

    i want lyrics of pandara pura vembha puttanagara alli vittobha

    Reply

  367. Posted by Chitra on May 2, 2012 at 10:37 am

    Praveenji….these are beautiful songs on Lord Shri Krishna

    Reply

  368. Posted by Meera Lakshmi Narasimhan on May 1, 2012 at 5:18 am

    Dear Meera,
    Great site.Wonderful service.
    These two lyrics have come on right time when festivities begin.Thank you for this fantastic service.A small request ,can anybody sing these lyrics and post it in you tube(just like the Keshava Nama and the rest) It would be very useful just as the other you tube songs have been.Thank You once again to all those involved (Smt Chitra,for posting these two songs and many more) and thanks esp to Smt Meera for her service.

    Reply

  369. Posted by praveen on April 28, 2012 at 10:52 pm

    any audio on lord krishna

    Reply

  370. Posted by Chitra on April 25, 2012 at 10:47 am

    Veena Maheshji, if you are asking for Aadhi Lakshmi devige aaratiya ethire lyrics, it has been posted just on april 24 in both English and kannada.

    Reply

  371. Posted by Veena Mahesh on April 25, 2012 at 7:02 am

    hi, can u please send lyrics of Adhi lakshmi ge arrthi

    Reply

  372. Posted by swetha on April 25, 2012 at 6:21 am

    lali govinda lali lyrics

    Reply

    • Posted by swetha on April 25, 2012 at 6:22 am

      lali govinda lali lyrics in kannada

      Reply

      • Posted by Srividya on December 13, 2013 at 6:05 am

        Hi swetha…

        Is this what you were looking for?

        ಲಾಲಿ ಗೋವಿಂದ ಲಾಲಿ
        ಕೌಸಲ್ಯ ಬಾಲ ಶ್ರೀ ರಾಮ ಲಾಲಿ
        ಲಾಲಿ ಮುನಿವಂದ್ಯ ಲಾಲಿ
        ಜನಕೀರಮಣ ಶ್ರೀ ರಾಮ ಲಾಲಿ

        ಪದ್ಮ ರಾಗವ ಪೋಲುವ ಹರಿ ಪಾದ
        ಪದ್ಮವನು ತಮ್ಮ ಹೃದಯ
        ಪದ್ಮದಲಿ ನಿಲ್ಲಿಸಿ ಪಾಡಿ ತೂಗಿದರು
        ಪದ್ಮಿನಿ ಭಾಮಿನಿಯರು

        ಕನಕಮಯ ಖಚಿತವಾದ ತಲ್ಪದಲಿ
        ವನಜಭವ ಜನಕನಿರಲು
        ವನಜನಾಭನ್ನ ಪಾಡಿ ತೂಗಿದರು
        ವನಿತಾ ಮಣಿಯರೆಲ್ಲರು

        ಆನಂದ ಸದನದೊಳಗೆ ಗೋಪಿಯರು
        ಆ ನಂದ ಸುತನ ಕಂಡು
        ಆನಂದ ಭರಿತರಾಗಿ ತೂಗಿದರು
        ಆನಂದ ಭೈರವಿಯಿಂದ

        ಪಲ್ಲವ ಧರೆಯರೆಲ್ಲ ಈ ಶಿಶುವು
        ತುಲ್ಯವರ್ಜಿತವೆನುತಲಿ
        ಸಲ್ಲಲಿತ ಗಾನದಿಂದ ತೂಗಿದರು
        ಕಲ್ಯಾಣಿ ರಾಗದಿಂದ

        ಇಂದುಧರ ಮಿತ್ರ ಜೋಜೋ ಶ್ರೀ ಕೃಷ್ಣ
        ಇಂದು ರವಿನೇತ್ರ ಜೋಜೋ
        ಇಂದು ಕುಲಪುತ್ರ ಜೋಜೋ
        ಪರಮಾತ್ಮ ಇಂದಿರಾ ರಮಣನೇ ಜೋಜೋ

        ತುಂಗ ಭವಭಂಗ ಜೋಜೋ ಪರಮಾತ್ಮ
        ರಂಗ ಕೃಪಾಂಗ ಜೋಜೋ
        ಮಂಗಳಾಪಾಂಗ ಜೋಜೋ
        ಮೋಹನಾಂಗ ರಂಗ ವಿಠ್ಠಲನೇ ಜೋಜೋ

  373. Posted by lalitha on April 25, 2012 at 5:34 am

    I need yogi manege banda lyrics in kannda

    Reply

    • Posted by Srividya on December 11, 2013 at 7:04 am

      ಯೋಗಿ ಮನೆಗೆ ಬಂದಾ I ಶ್ರೀ ಗುರುದೇವ ಮನೆಗೆ ಬಂದಾ II ಪ. II

      ಕಾಲಲಿ ಪಾದುಕ ಕೈಯಲಿ ದಂಡ I
      ಬಾಲ ರವಿಯ ಕಳೆಯ II ಅ. ಪ.II

      ಮಸ್ತಕದಲಿ ಜಡೆ ಶೋಭಿಸುತಿರಲು
      ಕಸ್ತೂರಿ ತಿಲಕ ಚಂದನ ಹಣೆಯಲ್ಲಿ
      ವಿಸ್ತಾರ ನಗೆ ಮೊಗದ II 1 II

      ಜೋಲುತಿರಲು ಕೊರಳೊಳು ರುದ್ರಾಕ್ಷ
      ಜೋಳಿಗೆ ಬಗಲಲಿ ತ್ರಿಲೋಕ ರಕ್ಷಾ
      ಕಾಷಾಯಾಂಬರದ II 2 II

      ಭಕ್ತ ಕಾಮ ಕಲ್ಪಧ್ರುವನೀತ
      ಸಚ್ಚಿದಾನಂದ ಶ್ರೀಗುರುದೇವ ದತ್ತ
      ಶಂಕರ ಗುರು ರೂಪ II 3 II

      ಕುರುದ್ವೀಪದಿ ಕೃಷ್ಣೆಯ ತಟದಲ್ಲಿ
      ಸರಸೀಜ ವಾಸಿಪ ಶ್ರೀಪಾದ ಯೋಗಿ
      ಪರಮ ಪುರುಷ ನರಹರಿ II 4 II

      Yogi manege banda I Shri gurudeva manege bada
      Kaalali paaduka kaiyali danda
      Baala raviya kaleya

      Mastkadali jade shobhisutiralu
      Kasthuri tilaka chandana haneyalli
      Vistaara nage mogada

      Joluthiralu koralolu rudraksha
      Jolige bagalali thriloka raksha
      Kaashaayaambarada

      Bhaktha kaama kalpadruvaneetha
      Sacchidananda gurudeva datta
      Shankara guru roopa

      Kurudweepadi krishneya tatadali
      Saraseeja vasipa sripada yogi
      Parama purusha narahari

      Can anybody post me the lyrics of ROMA ROMA KANNINALLI RAMA NAAMA – a popular song on Hanuman by Shri. Puttur Narasimha Nayak…?

      Thanks in advance.

      Srividya

      Reply

      • Posted by meeraghu on December 13, 2013 at 9:54 am

        Thanks, Srividya. Will post on the main page.

      • Posted by meeraghu on December 13, 2013 at 4:22 pm

        Srividya, who is the composer of this song?

      • Posted by Srividya on December 18, 2013 at 4:19 am

        Sorry Meera…I have no idea…but I’ve heard this song in the tune similar to “Dasanaagu Visheshanaagu Dasanaagu Bhavapaasha neegu” sung by Shri. Puttur Narasimha Nayak.

        Also, I’m not sure if the lyrics is ROMA ROMA KANNINALLI RAMA NAMA or simply ROMA ROMADALLI RAMA NAAMA.

        Thanks

  374. Posted by Chitra on April 24, 2012 at 2:16 pm

    S. Sankara Narayananji…here is the song you asked for aadi lakshmi devige aarathiya yetire

    ಆದಿಲಕ್ಷ್ಮಿ ದೇವಿಗೆ ಆರತಿಯ ಎತ್ತಿರೆ
    ಅರಿಶಿನ ಕುಂಕುಮ ಹಚ್ಚಿ ಹೂಮಾಲೆ ಹಾಕಿರೆ
    ಧಾನ್ಯಲಕ್ಷ್ಮಿಗೆ ನೀವು ಧೂಪ ದೀಪ ಹಚ್ಚಿರೆ
    ಕನಕಲಕ್ಷ್ಮಿಗೆ ನೀವು ನೈವೇದ್ಯವ ತನ್ನಿರೆ

    ಬಲದ ಕಾಲು ಮುಂದೆ ಇಟ್ಟು ಹೊಸಿಲು ದಾಟಿ ಬಾರಮ್ಮ
    ಭಾಗ್ಯ ತಾಯಿ ಮಾಂಗಲ್ಯ ಸೌಭಾಗ್ಯವ ನೀಡಮ್ಮ
    ಹಾಲು ತುಪ್ಪ ಹೊಳೆ ಹರಿಸಿ ಹರುಷ ಸುಖವ ತಾರಮ್ಮ
    ಧನ ಧಾನ್ಯವ ಕೊಟ್ಟು ಸಂತಾನ ಕರುಣಿಸಮ್ಮ

    ಕ್ಷೀರಾಬ್ದಿತನಯೇ ಆನಂದನಿಲಯೆ ವಿಷ್ಣುಪ್ರಿಯೆ ಬಾರೆ
    ಕಮಲನಯನೆ ನಿಜ ಕಮಲವದನೆ ಕಮಲಾಕ್ಷವಲ್ಲಭೆ ಬಾರೆ
    ಪುಷ್ಪಸುಗಂಧಿನಿ ಹರಿಣವಿಲೋಚನಿ ಕರುಣೆಯನ್ನು ತೋರೇ
    ಅನಂತರೂಪಿಣಿ ಚಿರಸುಖದಾಯಿನಿ ಇಷ್ಟಾರ್ಥವನೇ ತಾರೆ

    Aadhi Lakshmi Devige aaratiya ethire
    arishina kumkuma hacchi hoomaale haakire
    Dhaanyalakshmige neevu dhoopa deepa hacchire
    Kanakalakshmige neevu naivedyava thannire

    Baladha kaalu mundhe ittu hosilu daati baaramma
    Bhaagya thaayi maangalya sowbhaagyava needamma
    haalu tuppa hoLe harisi harusha sukava thaaramma
    dhana dhaanyava kottu santhaana karunisamma

    Ksheeraabdithanaye aanandanilaye vishnupriye baare
    kamalanayane nija kamalavadhane kamalaakshavallabhe baare
    pushpasugandhini hariNavilochani karuNeyannu thore
    anantharoopiNi chirasukhadaayini ishtaarthavane thaare

    Reply

  375. Posted by Chitra on April 24, 2012 at 12:37 pm

    S. Sankara Narayananji…here is the song you aske for Indhu Shukravaara

    ಸರ್ವ ಮಂಗಳ ಮಾಂಗಲ್ಯೇ ಶಿವೆ ಸರ್ವಾರ್ತ ಸಾಧಕೆ
    ಶರಣ್ಯೇ ತ್ರಯ೦ಬಕೆ ದೇವಿ ನಾರಾಯಣಿ ನಮೋಸ್ತುತೆ

    ಇಂದು ಶುಕ್ರವಾರ ಶುಭವ ತರುವ ವಾರ
    ಸುಮಂಗಲಿಯರೆಲ್ಲಾ ನಿನ್ನ ಪೂಜಿಸುವ ಪುಣ್ಯವಾರ

    ಮುಂಜಾನೆಯ ಮಡಿಉಟ್ಟು ಕುಂಕುಮವ ಹಣೆಗಿಟ್ಟು
    ರಂಗೋಲಿಯ ಬಾಗಿಲಿಗಿಟ್ಟು ಹಣ್ಣು ಕಾಯಿ ನೀಡುವ ವಾರ

    ಮಲ್ಲಿಗೆ ಜಾಜಿ ಹೂಮಾಲೆ ಹಾಕಿ ಚಂದನ ಹಚ್ಚಿ ಸಿಂಗಾರ ಮಾಡಿ
    ಕರ್ಪೂರದಾರತಿ ನಿನಗೆ ಬೆಳಗಿ ಭಕ್ತಿಯಿ೦ದಲಿ ಭಜಿಸುವ ವಾರ

    ಸುವಾಸಿನಿಯರಿಗೆ ಕುಂಕುಮ ಹಚ್ಚಿ ಸಂಭ್ರಮದಿ೦ದ ಬಾಗಿಣ ನೀಡಿ
    ಸರ್ವ ಮಂಗಲೆಯ ಕೀರ್ತಿಯ ಹಾಡಿ ಸಕಲ ಭಾಗ್ಯವ ಬೇಡುವ ವಾರ

    Sarva Mangala Maangalye Shive Sarvaarta Saadake
    Sharanye Trayambake Devee Naaraayani Namostuthe

    Indhu shukravaara shubhava taruva vaara
    Sumangaliyarella ninna poojisuva punyavaara

    Munjaaneya madiuttu kumkumava hanegittu
    Rangoliya baagiligittu hannu kaaayi needuva vaara

    Mallige jaaji hoomaale haaki chandana hacchi singara maadi
    Karpoora daarati ninage belagi bhakti indali bajisuva vaara

    Suvaasiniyarige kumkuma hacchi sambramadindha baagina needi
    Sarva mangaleya keerthiya haadi sakala bhaagyava beduva vaara

    Reply

  376. Posted by Chitra on April 24, 2012 at 11:35 am

    yeah, sure Lakshmanji :

    Raaga: Hindola Taala: Thriputa

    Aaratiyanu belagire Shreedevi sahitha Vittalage

    Gejjenaadada hejje ikkuva udupi Baala Mukundage
    Ranganaayaki Ramanage, Shree Ranganatha Swamige

    Kambadindali udhisi bandha kamalapathi Narasimhage
    Vaamanaa vatuvaagi bandhage venkatachala vaasage

    Rukmineesha Krishnage jaya Jaanakipathi Raamage
    Jagava udaradhi darisiha Jaya Rama Vittala Devage

    Reply

  377. Posted by kiran on April 24, 2012 at 3:34 am

    i need lali govinda lali lyrics writen by sripadarajaru plz….. give me

    Reply

  378. chitra:
    Would you be kind enough to post the lyrics of the Arati song in English script? Thanks.

    Reply

  379. Adiyali gajamukhana arcisi. rAgA: nATa.

    Adiyali gajamukhana arcisi Arambhisalu Ava bage kAryatati siddhi goLisi
    mOdadim salisuva manadiSTava sAdhu janarella kELi sakala suraringe
    mAdhavanE nEmisippa I adhikArava Adaradinda avaravaroLu
    nindu kAryagaLa bhEda koLisade mALpa purandara viTTala

    Reply

  380. Posted by Prasad on April 22, 2012 at 8:24 pm

    Hello Meera, Can you please share the lyrics of Adiyali Gajamukhane (http://www.youtube.com/watch?v=VJgL7LgBkGA).. thank you.

    Reply

  381. Posted by Chitra on April 20, 2012 at 9:00 pm

    There is one more aarti song

    ಆರತಿಯನು ಬೆಳಗಿರೆ ಶ್ರೀದೇವಿಸಹಿತ ವಿಠಲಗೆ II ಪ II

    ಗೆಜ್ಜೆನಾದದ ಹೆಜ್ಜೆ ಇಕ್ಕುವ I ಉಡುಪಿ ಬಾಲ ಮುಕುoದಗೆ
    ರಂಗನಾಯಕಿ ರಮಣಗೆ I ಶ್ರೀ ರಂಗನಾಥ ಸ್ವಾಮಿಗೆ

    ಕಂಬದಿಂದಲಿ ಉದಿಸಿ ಬಂದ I ಕಮಲಪತಿ ನರಸಿಂಹಗೆ
    ವಾಮನ ವಟುವಾಗಿ ಬಂದಗೆ I ವೆಂಕಟಾಚಲ ವಾಸಗೆ

    ರುಕ್ಮಿಣೀಶ ಕೃಷ್ಣಗೆ I ಜಯ ಜಾನಕಿಪತಿ ರಾಮಗೆ
    ಜಗವ ಉದರದಿ ಧರಿಸಿಹ I ಜಯರಾಮವಿಠಲ ದೇವಗೆ

    Reply

  382. Is this one of the songs?

    Aratiya beLagire. rAgA: shrI. aTa tALA. Purandaradasa.

    P: Aratiya beLagire
    C1: arasi rukmiNi kUDa arasu viTTalage birudina shankhava piDida viTTalage
    sarasija sambhava sannuta viTTalage niruta iTTige mEle ninta viTTalage
    2: dasharatharAyana udaradi viTTala shishuvAgi janisida shrI rAma viTTala
    pashupati gOpiya kandane viTTala asure pUtaniya konda viTTalage
    3: kaNDira bobbura venkaTavittalana aNDaja vAhana ahudO nI vittala
    pANduranga kSEtra pAvana viTTalA puNDarIkAkSa shrI purandara viTTalage

    Reply

  383. Posted by shubha rao on April 19, 2012 at 2:54 pm

    Hi Meeraji,

    Krishna na aaruthi songs yavdaadru post maadakke aagatta?
    And ii erd songs du lyrics gottidre post maadi.
    1) aaruthi belagire ma ramanage vara nariyaru paramaadaradi….
    2) belaguvenaaruthiya naanu balakrishna ge….

    Thanks,
    Shubha

    Reply

    • Posted by Shubha on January 29, 2013 at 7:41 pm

      Hi Meeraji,

      I got this lyrics from my mom but she has forgotten the last paragraph.

      ಆರುತಿ ಬೆಳಗಿರೆ ಮಾ ರಮಣಗೆ ವರ ನಾರಿಯರು ಪರಮಾದರದಿ
      ಸಾರುತ ಹರಿಗುಣ ಬೀರುತ ಮುದದಲಿ ಸರಸಿಜ ನಯನಗೆ ಹರುಷದಲಿ

      ನಿಗಮ ಕಾಯ್ದು ತಾ ನಗ ಬೆನ್ನಲಿ ಪೊದ್ದು ಅಗಿದು ಬೇರು ಮೆತ್ತ ವರಹನಿಗೆ
      ಮಗುವಿನ ಗೋ ಸುಗ ನಗುತ ಕಂಬದಿ ಬಂದ ಜಗದೊಡೆಯಗೆ ಬೇಗ ಸುಗುಣೆಯರು

      ಸುಂದರ ವಾಮನ ನಿಂದು ಭಾರ್ಗವಗೆ ರಂಭೆ ಅಹಲ್ಯೋಧಾರಕೆಗೆ
      ಸುಂದರ ಗೋಪಿ ವೃಂದದ ಕುಣಿಯುವ ನಂದನಿಗೆ ಗೋಪಿ ಕಂದನಿಗೆ

      Will upload the rest as soon as I get it. 🙂

      Shubha

      Reply

  384. Posted by Chitra on April 15, 2012 at 1:12 pm

    Here are the lyrics for ರಾಮ ಮಂತ್ರವ ಜಪಿಸೋ

    ರಾಮ ಮಂತ್ರವ ಜಪಿಸೋ ಹೇ ಮನುಜ
    ರಾಮ ಮಂತ್ರವ ಜಪಿಸೋ
    ಆ ಮಂತ್ರ ಈ ಮಂತ್ರ ಜಪಿಸಿ ಕೆಡಲು ಬೇಡ
    ಸೋಮಶೇಖರ ತನ್ನ ಭಾಮೆಗ್ಹೆಳಿದ ಮಂತ್ರ

    ಕುಲಹೀನನಾದರು ಕೂಗಿ ಜಪಿಸೋ ಮಂತ್ರ
    ಸಲೆಬೀದಿಯೊಳು ಉಚ್ಚರಿಸುವ ಮಂತ್ರ
    ಹಲವು ಪಾಪಂಗಳ ಹದಗೆಡಿಸುವ ಮಂತ್ರ
    ಸುಲಭದಿಂದಲಿ ಮೋಕ್ಷ ಸೂರೆಗೊoಬುವ ಮಂತ್ರ

    ಮರುತಾತ್ಮಜ ನಿತ್ಯ ಸ್ಮರಣೆ ಮಾಡುವ ಮಂತ್ರ
    ಸರ್ವ ರಿಶಿಗಳಲಿ ಸೇರಿದ ಮಂತ್ರ
    ದುರಿತ ಕಾನನಕಿದು ದಾವಾನಲ ಮಂತ್ರ
    ಪೊರೆದು ವಿಭೀಷಣಗೆ ಪಟ್ಟಗಟ್ಟಿದ ಮಂತ್ರ

    ಜ್ಞಾನನಿಧಿ ನಮ್ಮ ಆನ೦ದ ತೀರ್ಥರು
    ಸಾನುರಾಗದಿ ನಿತ್ಯ ಸೇವಿಪ ಮಂತ್ರ
    ಭಾನು ಕುಲಾ೦ಬುಧಿ ಸೋಮನೆನಿಪ ನಮ್ಮ
    ದೀನ ರಕ್ಷಕ ಪುರಂದರವಿಠಲನ ಮಂತ್ರ

    Reply

  385. Posted by Chitra on April 15, 2012 at 12:42 pm

    Here are the lyrics for ಕಂಡೆನಾ ಗೋವಿಂದನ

    ಕಂಡೆನಾ ಗೋವಿಂದನ
    ಪುಂಡರೀಕಾಕ್ಷಪಾಂಡವ ಪಕ್ಷ ಕೃಷ್ಣನ

    ಕೇಶವ ನಾರಾಯಣ ಶ್ರೀ ಕೃಷ್ಣನ
    ವಾಸುದೇವ ಅಚ್ಯುತಾನಂತನ
    ಸಾಸಿರ ನಾಮದ ಶ್ರೀ ಹೃಷಿಕೇಶನ
    ಶೇಷ ಶಯನ ನಮ್ಮ ವಸುದೇವ ಸುತನ

    ಮಾಧವ ಮಧುಸೂದನ ತ್ರಿವಿಕ್ರಮನ
    ಯಾದವ ಕುಲ ವ೦ದ್ಯನ
    ವೇದಾಂತ ವೇದ್ಯನ ಇಂದಿರಾ ರಮಣನ
    ಆದಿ ಮೂರುತಿ ಪ್ರಹ್ಲಾದವರದನ

    ಪುರುಷೋತ್ತಮ ನರಹರಿ ಶ್ರೀ ಕೃಷ್ಣನ
    ಶರಣಾಗತ ಜನ ರಕ್ಷಕನ
    ಕರುಣಾಕರ ನಮ್ಮ ಪುರಂದರವಿಠಲನ
    ನೆರೆ ನ೦ಬಿದೆನು ಬೇಲೂರ ಚೆನ್ನಿಗನ

    Reply

  386. rAma mantrava japisO. rAgA: madhyamAvati. Adi tALA. Purandaradasa.

    P: rAma mantrava japiso hE manujA
    A: A mantra I mantra necci nI keDabEDa sOmashEkhara tanna bhAmini gorediha
    C1: kula hInanAdarau kUgi japisuva mantra sale bIdiyoLu uccaripa mantra
    halavu pApangaLa hadageDisuva mantra sulabhadindali svarga sUre kombuva mantra
    2: marutAtmaja nitya smaraNe mADuva mantra sarvarSigaLalli sErida mantra
    durita kAnanakidu dAvAnala mantra poredu vibhISaNage paTTa kaTTida mantra
    3: snAna maunangaLige sAdhanada mantra mAnvaru manadi dhyAnipa mantra
    hIna guNangaLa hisukutiha mantra Enembe vibhISaNage sAravinibha mantra
    4: sakala vEdagaLige sAravenipa mantra mukuti mArgake idE mUla mantra
    bhakuti rasake ommebaTTe tOruva mantra sukhanidhi purandara viTTalana mahA mantra
    5: jnAnanidhi namma Ananda tIrttaru sAnurAgadi nitya sEvipa mantra
    bhAnu kulAmbudhi sOmanenipa namma dInarakSaka purandara viTTalana mantra

    kaNDenA gOvindana. rAgA: kAmavardhani / varam. Adi tALA. Purandaradasa.

    P: kaNDenA gOvindana puNDarIkAkSa pANDava pakSa krSNana
    C1: kEshava nArAyaNa shrI krSNana vAsudEva acyutAnandana
    sAsira nAmada shrI hrSIkEshana shESashayana namma vasudEva sutana
    2: mAdhava madhusUdana trivikramana yAdava kula vandyana
    vEdAnta vEdyana indirA ramaNana Adi mUruti prahlAda varadana
    3: puruSOttama narahari shrI krSNana sharaNAgata rakSakana
    karuNAkara namma purandara viTTalana nere nambidenu bElUra cennigana

    Reply

  387. Posted by S. Sankara Narayanan on April 12, 2012 at 6:53 am

    Can any one give me the lyrics of the following Kannada devotional songs.

    1.Indu Sukravara 2. Kandena Govindana 3. Rama mantrava japiso 4. adi lakshmi devige aarathiya yetire

    Thanks in advance.

    Reply

  388. lAli gOvinda lAli. rAgA: Anandabhairavi. jhampe tALA. Shripadaraya.

    P: lAli gOvinda lAli kausalyA bAla shrIrAma lAli
    A: lAli munivandya lAli jAnakI ramaNa shrIrAma lAli
    C1: kanakaratnagaLalli kAlgaLane hUDi nAlku vEdagaLannu sarapaNiya mADi
    anEka bhUmaNDalava halageya mADi shrIkAntanuyyAleyanu viracisidaru
    2: AshcaryajanakavAgi nirmisida pacceya toTTilalli
    acyutAnantaniralu tUgidaru matsyAvatAra hariya
    3: dharmasthApakanu endu niravadhika nirmala caritranendu
    marma karmagaLa pADi tUgidaru kUrmAvatAra hariya
    4: sarasijAkSiyarellaru janavashI kara divya rUpanendu
    parama haruSadali pADi tUgidaru varAhAvatAra hariya
    5: kari kumbhagaLa pOluva kucadalli hAra padakavu hoLeyalu
    varavarNiniyaru pADi tUgidaru narasimhAvatAra hariya
    6: bhAmAmaNiyarellaru yaduvamsha sOmanivanendu pogaLi
    nEmadindali pADi tUgidaru vAmanAvatAra hariya
    7: sAmajavaradanendu atuLa bhrugu rAmAvatAranendu
    shrImadAnanda hariya tUgidaru prEmAtirEkadinda
    8: kAmanige kAmanendu surasArva bhauma guNadhAmanendu
    vAmanEtreyaru pADi tUgidaru rAmAvatAra hariya
    9: sruSTiya kartanendu jagadoLage shiSTa santuSTanendu
    druSTAntarahitanendu tUgidaru kruSNAvatAra hariya
    10: vruddha nAriyarellaru jagadoLage prasiddha nivanendu pogaLi
    baddhAnurAgadinda tUgidaru bauddhAvatAra hariya
    11: ThaLaThaLatkAradinda ranjisuva malayajalEpadinda
    jalajagandhiyaru pADi tUgidaru kalkyAvatAra hariya
    12: kanakamaya khacitavAda talpadali vanajabhava janakaniralu
    vanajanAbhanna pADi tUgidaru vanitAmaNiyarellaru
    13: padmarAgava pOluva haripAda padmavanu tamma hrudaya
    padmadali nillisi pADi tUgidaru padminI bhAminiyaru
    14: hastabhUSaNa mereyalu divyatara hastalAghavagaLinda
    hastagaLa piDidukonDu tUgidaru hastinI bhAminiyaru
    15: mattagajagAminiyaru divyatara citra vastragaLanuTTu
    citta santOSadinda tUgidaru cittinI bhAminiyaru
    16: kankaNa dhvanigaLinda ranjisuva kinkiNI svaragaLinda
    pankajAkSiyaru pADi tUgidaru shankinI bhAminiyaru
    17: cokka kastUri pankadim ranjisuva makarikA patra baredu
    likucastaniyaru pADi tUgidaru akaLanka carita hariya
    18: pallavAdhareyarella I shishuvu tulyavarjitavenutali
    sallalitagAnadinda tUgidaru kalyANi rAgadinda
    19: Ananda sadanadoLage gOpiyaru A nandasutana kaNDu
    AnandabharitarAgi tUgidaru Anandabhairaviyinda
    20: dEvAdidEvanendu I shishuva bhAvanAtItanendu
    dEvagandharvaru pADi tUgidaru dEvagAndhAradinda
    21: nIla ghanalIla jO jO karuNAlavAla shrIkruSNa jO jO
    lIlAvatAra jO jO paramAtma bAlagOpAla jO jO
    22: indudharamitra jO jO shIkruSNa indu ravi nEtra jO jO
    inDu kulaputra jO jO paramAtma indirAramaNa jO jO
    23: tunga bhavabhanga jO jO paramAtma ranga krupAnga jO jO
    mangaLApAnga jO jO mOhanAnga rangaviThalane jO jO

    Reply

  389. Posted by kiran kumar on April 10, 2012 at 3:30 am

    sir, i want lali govinda lali lyrics please………………………..!

    Reply

  390. Posted by Chitra on March 28, 2012 at 3:07 pm

    Found a very great site. Thanks to one and all

    Reply

  391. Posted by Radhika on March 14, 2012 at 9:53 am

    thanks for lyrics

    Reply

  392. Posted by nagarajan.g on March 12, 2012 at 6:23 am

    a great site iam happy to see this

    Reply

  393. where can i lister to this song recited words are very good, I understand the mening but not sure enough to translate. shyamala.

    Reply

  394. Appreciate it if someone can give a running meaning for the song on hanumAn. Thanks in advance.
    rAga : hindusthAni kApi/pUrvikalyANi tALam: ATa/Adi
    p. sAri bandane prANESha bandane
    a. sAri bandalangkApurava mIrida rAvaNana kaNDu dIranu vayyAradinda
    c1. vAyu putrane ShrI rAmana dUtane
    prIyadinda sItAnganege
    mudrikeya tandittavane
    c2. bhImasEnane kuntI tanayane
    virATaNa maneyali nintu
    kIcakana samharisidane
    c3. madhvarAyane sarvajna ShrEshTane
    advaitava geddu
    purandara viThalana munde nintane

    Reply

  395. Posted by Parimala on February 23, 2012 at 11:22 pm

    Hi Meera,

    Please can you provide the lyrics for Sri Madramapadaravinda
    Madhupaha (Raghavendra Mangalaskatam) if you have.

    I appreciate your effort in putting up all the Madhwa rituals and the devotional songs with lyrics.

    Thanks,
    Parimala

    Reply

  396. can you send me “sumukashcha ekdanta” sloka
    regards shekar

    Reply

  397. Posted by Gowri Venk Narasimhan on February 2, 2012 at 12:17 am

    Hi

    I am searching for Sri Raghavendra suprabadham can you kindly post the lyrics if you have it. Thanks.

    Regards,
    Mrs. Gowri Venkat Narasimhan

    Reply

  398. Posted by Divya on January 21, 2012 at 9:38 am

    Hello,
    I am searching for “Hanumantha Deva Namo” in Poorvikalyani by Purandaradasa. Can you kindly post the lyrics if you have it. Thanks. This is a great website.

    Regards,
    Divya.

    Reply

    • Posted by Lakshman on February 19, 2012 at 2:16 am

      hanumanta dEva . rAgA: bhUpALi. Eka tALA.

      P: hanumanta dEva namO
      A: vanadhiyanu dATi dAnavara daNDisida
      C1: anjaneya garbha puNyOdayanendenipe kanja sakha maNDalake kai tuDukide
      bhunji sIrELu jagangaLanu uLuhide bhanjanAtmaja guruve sari kANe ninage
      2: hEmakuNDala hEma yajnOpavItakhiLa hEma kaTi sUtra kaupInadaHri
      rOma kOTi linga sarva shyAmala varNa rAma bhrtyane ninage sari kANe guruve
      3: akSaya kumArakana niTTorasi pisuTu nI rAkSasAdhipa rAvaNanu raNadali
      vakSa sthaLadalli shikSisalu mUrceya bakeya rakSisite rakSisite rAya balavanta
      4: rAma lakSmaNara kaNDALAgi nI merade bhUmijege mudreyunguravanitte
      A mahA lankA nagara vellavanu suTTu dhUmadhAmava mADi aLideyA mahAtma
      5: shrImadAcAryara purapatiyendenipa shrI mahAlakumi nArAyaNa rUpa
      shrI manOhara purandara viTTala rAyana saumya manadALu hanumanta balavanta

      Reply

  399. Posted by Poornima Nayak on January 20, 2012 at 1:17 pm

    Dear Meera Mam,

    i am a pgdhrm from india and in very trouble to give good health to my baby. Please guide me to US so that I can start my life on my own and give good health to my baby. My husband doesnt support me and in very tragic situation. I will be very grateful to you if you help me in getting any job in US for a small start of my life.
    My email is imriaporsche@gmail.com
    waiting for your reply,
    poornima

    Reply

  400. Posted by Veena Bheemesh on January 14, 2012 at 11:42 am

    Can you please publish the famous aarthi song Srinatha Govinda anandha mooruthige…….

    Reply

  401. Posted by Praveen Biligiri on January 8, 2012 at 1:09 am

    can I have lyrics of “Dimbadalliruva Jeeva…” please?

    Reply

  402. Posted by Narayan Kulkarni on January 5, 2012 at 11:46 am

    hats off to you……can we have a lyrics of Hanumantha hanumantha……..and one more song tangigehelida krishna…..and one more pls hosa kannu yenage needalibeku jagadamba……

    Reply

    • Posted by Lakshman on February 19, 2012 at 2:07 am

      tangig-hELida. rAgA: kAmbhOji. jhampe tALA. Composer: Purandaradasa.

      P: tangig-hELida krSNa candadali buddhi
      A: atteya maneyalli iruvantha suddi
      C1: yArEnu andaru mOreyanu tiruhadiru mOre mEle kaiyetti ballaLendeNisi
      vArgEvara kUDi nIrannu taruvAga vAre kaNNisi nODa nODadiru kaNDya
      2: parara oDaveya kaNDu duruLa mAtADadiru nerehoreyarige nInu talevAgi naDeya
      parara mAtugaLinda duruLendu enisa bEDa nerehoreyara kaNDu nI baduku mADamma
      3: bhangArada pETeyoLu angaDige hOgadiru anganErige mAna bhangAgi maDeya
      anganErige ninnantarangava hELadiru bhangAra vastugaLu mucci koLLamma
      4: hAgiddu nInuNDu bEkendu bEDadiru sAku sAku emba nAcikeya hiDiye
      nAkumandiyaroDane kOke mAtADadiru lOkadoLivaLobba mUgiyendenise
      5: iSTaru andaru niSTUravADadiru ghaTTi mADamma ninna manasu
      shrSTiyoLage namma purandara viTalanna shrESTanAda krSNanna tangiyendenisise

      Reply

  403. Posted by Janardhan R. Hungund on January 5, 2012 at 7:05 am

    Hi Meera Madam,
    This is an amazing collection of lyrics which is very rare to find even in the whole internet world. I really appreciate this effort to note down the lyrics. I accidentally found your site while searching for the lyrics of Kannada devotional song. I was so disappointed as I could not find any site in my first attempt. I had almost made-up my mind to create a blog/web-site similar to yours. But, I am relieved that there are people like you who are working so hard to put together the lyrics of Kannada songs. I will not give up my resolution. I will try to provide you the lyrics of many other songs not listed here treating it as an “alilu seva” for the big task that you are doing.

    Hats off for this effort.

    Regards,
    Janardhan

    Reply

    • Posted by meeraghu on January 5, 2012 at 8:42 am

      Hi Janardhan Sir,
      Appreciate your comment. Yes, please do provide me any lyrics you have. I will post it in the blog.

      Reply

  404. I am new to this site.
    I need a song about hanumantha Nice one To sing for madhwa jaayanthi
    Any one can help Me?
    Happy new year to all.
    shyamala.

    Reply

  405. Posted by Gopal on December 31, 2011 at 1:38 am

    hello Meera Madam,
    its really a vry nice blog …and very usefull too
    well can u pls upload lyrics of song “Yesthu Helali Venkata Giriya, drusthi ge bahu siriya “.

    Reply

  406. Posted by Nandini on December 29, 2011 at 5:17 am

    do u have the lyircs of mangalam shubh mangalam ityam shubh mangalam

    Reply

  407. Posted by swathi on December 27, 2011 at 5:10 am

    hello its really a vry nice blog …. appreciations to ur efforts.. well can u pls upload the lyrics for INTHU POGALENNAMA SrIKAANTHANA PAADA..thnx in adv..

    Reply

  408. Posted by Shiva Narayan on December 14, 2011 at 2:23 am

    Hi Meera

    I was earlier able to found lyrics for preenayamo .. Now its no longer there.. says page lost.
    Could you please reload that lyrics. I love that song very much

    Btw you do a great job maintaining this website. really helpful 🙂

    Regards
    Shiva

    Reply

  409. Posted by Mahadeva on December 9, 2011 at 3:28 am

    Hi meera do you have ayyappa swamy astottara?

    Reply

  410. Posted by Mahadeva on December 8, 2011 at 9:48 pm

    ಧನ್ಯವಾದಗಳು

    Reply

  411. Posted by Mahadeva on December 8, 2011 at 9:45 pm

    Nanage tumba tumba santosha aagta ide nimma e-web sikkiddu.. Thank u thank u very much for your marvaless collection, ಧನ್ಯವಾದಗಳು

    Reply

  412. Posted by Mahadeva on December 8, 2011 at 9:43 pm

    Nanage tumba tumba santosha aagta ide nimma e-web sikkiddu.. Thank u thank u very much for your marvaless collection,

    Reply

  413. Thank you so much for the Hanumath ashtakam. can I have the rest of the slokam?

    thank you so much for your help.

    vijay

    Reply

  414. I managed to transcribe three stanzas of the aSTakam. Corrections welcome:

    1: shrI raghurAja padAbja nikEtana pankaja lOcana mangaLa rAjE
    khaNDa mahAbhuja daNDa suradidhi khaNDana paNDita pAhi dayALO
    pAtakinca samumuddAramAm mahatangitatam ati mAnam udAram
    tvAm bhajatO mama dEhi dayAdhana hE hanumantva padAmbujadAtyam
    2: samskrti tApa mahAnala takkasarUruha manmathanOrmatidEram
    putra tansava janat-madhuhAdishuttamadE rati kilbishamUrtE
    tEna cirabhayam adEnapurakrta puNya sukunjala dEnadisOvai
    tvAm bhajatO mama dEhi dayAdhana hE hanumantva padAmbujadAtyam
    3: samskrti dhUjam analpama ghAninadhadha nidhAnamajastra sESam
    prAkhya sudukhkhata hastra bhujanga visharkata matula sarvatanurti
    ghOra mahA krpANa padamEva gatarsya harE harE pati tasya bhavAbdau
    tvAm bhajatO mama dEhi dayAdhana hE hanumantva padAmbujadAtyam

    I m

    Reply

    • I Found this while i was frantically searching for hanumadashtakam…hope this helps a few here.

      shrI raghurAja-padAbjaniketana pa.nkajalochana ma.ngalarAshe,
      chaNDa-mahAbhuja-daNDa-surArivi-khaNDanapaNDita pAhi dayAlo |
      pAtakinaM cha -samuddhara mAM- mahatAM hi satAmapi mAnamudAraM,
      tvAM bhajato mama dehi dayAghana he hanumatsvapadAmbujadAsyam || 1||

      sa.nsR^ititApamahAnaladagdhatanUrUhamarmatanoratibelaM,
      putradhanasvajanAtmagR^ihAdiShu sak{}tamateratikilbiShamUrteH |
      kenachidapyamalena purAkR^itapuNyasupu.njalavena vibho vai, tvAM
      bhajato… || 2||

      sa.nsR^itikUpamanalpamaghoninidAghavidAnamajasramasheShaM,
      prApya suduHkhasahasrabhuja.ngaviShaikasamAkulasarvatanorme |
      ghoramahAkR^ipaNApadameva gatasya hare patitasya bhavAbdhau, tvAM
      bhajato… || 3||

      sa.nsR^itisindhuvishAlakarAlamahAbalakAlajhaShagrasanArtaM,
      vyagrasamagradhiyaM kR^ipaNaM cha mahAmadanakrasuchakrahR^itAsum |
      kAlamahArasanorminipIDitamuddhara dInamananyagatiM mAM, tvAM
      bhajato… || 4||

      sa.nsR^itighoramahAgahane charato maNira.njitapuNyasumUrteH,
      manmathabhIkaraghoramahogramR^igapravarArditagAtrasusandheH |
      matsaratApavisheShanipIDitabAhyamateshcha katha.nchidameyaM, tvAM
      bhajato… || 5||

      sa.nsR^itivR^ikShamanekashatAghanidAnamanantavikarmasushAkhaM,
      duHkhaphalaM karaNAdipalAshamana.ngasupuShpamachintyasumUlam |
      taM hyadhirUhya hare patitaM sharaNAgatameva vimochaya mUDhaM, tvAM
      bhajato… || 6||

      sa.nsR^itipannagavak{}trabhaya.nkarada.nShTramahAviShadagdhasharIraM,
      prANavinirgamabhItisamAkulamandhamanAthamatIva viShaNNam |
      mohamahAkuhare patitaM dayayoddhara mAmajitendriyakAmaM, tvAM
      bhajato… || 7||

      indriyanAmakachauragaNaihR^irtatatvavivekamahAdhanarAshiM,
      sa.nsR^itijAlanipAtitameva mahAbalibhishcha vikha.nDitakAyam |
      tvatpadapadmanuttamamAshritamAshu kapIshvara pAhi kR^ipAlo, tvAM
      bhajato… || 8||

      brahmamarUdgaNarUdramahendrakirITasukoTilasatpada pIThaM
      dAsharathiM jayati kShitimaNDala eSha nidhAya sadaiva hR^idabje |
      tasyahanUmata eva shiva.nkaramaShTakametadaniShTaharaM vai,
      yaH satataM hi paThetsa naro labhate.achyutarAmapadAbjanivAsam || 9||

      || shrImadhusUdanAshramashiShyAchyutavirachitaM shrImaddhanumadaShTakaM
      saMpUrNam ||

      Reply

  415. Dear any one,

    I want the stotram lyrics for P.b. srinivas sri Hanumath ashtakam. can anyone reply with the lyrics?

    it starts with sri raghu raja padam budinikethana pankaja lochana mangala daye

    thank you,

    vijay_suresh @comcast.net

    Reply

  416. Hi friends ,

    Any one of u please send me the audio track for the song “Angala dola ramanaaditha””.

    thanks

    charu

    Reply

  417. Hi praveen ji ,

    hope u have received my mail … here i have found the link for the song “venunaatha baaro”..
    please find the below link

    regards

    charu

    Reply

  418. I would like to have the lyrics for the sloka sri hanumath ashtakam sung by p.b, srinivas , composed by madusudana srama sishyath virachitam.

    it starts with sri raghu raja padabhtinikethana pankaja lochana mangala dase……………..sri hanumath swapadam buja dashyam . audio format is availble in http://www.4shared.com/audio/FdZ6iceB/Sri_Hanumadashtakam_-_PBS__1_.html

    thank you so much

    Reply

    • Hi there, I have posted Srimad Hanumadashtakam in few different language scripts on my blog, I hope you will find it helpful, the link to the site is

      http://gscooking.blogspot.com/p/shlokas-and-etc.html

      Reply

    • Sri Raghu raja padabja niketana pankajalochana mangla rashe
      Chanda maha bhuja danda surathibhi khandana panditha pahi dayalo
      Pathathinam jasamudhtharamam mahathaamhisathamabhimanamudharam
      Swambhajatho mama dehithadhyakhana he hanumaswapadambhuja dasyam

      Samsrithi thapa mahalanaladatha thanuruha marmathanorathibeeham
      Puthra dhanswajanathma gruhathishu sakthamathee rathikhilmishamurthee
      Hena chithabhyama lena purakrutha punya supunchala vena vibhoovayu
      Swambhajatho mama dehithadhyakhana he hanumaswapadambhuja dasyam

      Samsrithi koopamanalpamaghani nidagha nindanamajshramashehsam
      Prapya sudukha sahshra bhujanga vishykha samakhula sarvathanoormyee
      Khora mahathrupana pada meva gadasya hare pathi thasya bhava bhau
      Swambhajatho mama dehithadhyakhana he hanumaswapadambhuja dasyam

      Samsrithi sindhu vishaala karaala mahabala kaala chashagra sanartham
      Yagra samgradhiyanthru panamcha mahamadanakra suchakra hirdaasum
      Kaala maha rasanorminipeeditha mudhara deenamananyaka thinma
      Swambhajatho mama dehithadhyakhana he hanumaswapadambhuja dasyam

      Samsrithi khora maha gahalechara thoma niranjitha punya sumurthe
      Manmatha bheegara khora mahoogra mrugapravarathitha gathra susandhye
      Mathsara thapa visheshanipeeditha bahyamatheschaka damchithameeyam
      Swambhajatho mama dehithadhyakhana he hanumaswapadambhuja dasyam

      Samsrithi vrukshamanegha shathagha nidanamanatha vikarma sushagham
      Dukhabhalam karanadi palashamananga supushpama chinthyasumoolam
      Ramyadhiruhya hareepathitham sharanagathameva vimoochayamoodam
      Swambhajatho mama dehithadhyakhana he hanumaswapadambhuja dasyam

      Samsrithi pannaga vakthra bhayangara damshtra maha visha daghtha shareeram
      Prana vinirgama bheethi samakula nandamanadhamatheeva vishannam
      Moha mahakuhareepathitham dayayotharamamajitheenthiriya kaamam
      Swambhajatho mama dehithadhyakhana he hanumaswapadambhuja dasyam

      Inthriya namaka chaura ganairhritha thathva viveeka mahadhanaraashim
      Samsrithi jalalipathithameva mahabali vischa vigandhitha kayam
      Vathpada pathmamanuthamamashritha mashukapeeshwara parikripaloo
      Swambhajatho mama dehithadhyakhana he hanumaswapadambhuja dasyam

      Brahmamarugana rudhramaheendra kireeda sukoodila sathpadapeedam
      Dasharadinthyathikshithi mandala yeshanidaya sadaiva hridathyee
      Thasya hanumatheyava shivakaram ashtakameeda danishta haramvayyu
      Yassa thatham hi padeth sanaroolapatheekshutha ramapadabhya nivasam

      Ithi sri madusoodanamshrama shishychutha virachitham
      srimadhanumathashtakam sampoornam

      Reply

  419. O rAma nI nAmamEmi. rAgA: yamunAkalyANi. Adi tALA.

    P: O rAma nI nAmamEmi rucirA shrI rAma nI nAmamenta rucirA
    A: enta rucirA rAma Emi rucirA rAma O rAmA nI nAmam enta rucirA
    C1: madhu rasamulakaNTE dadhi ghrtamulakanTE atirasamagu nAmamEmi rucirA
    2: navarasa paramAnna navanItamulakaNTE nadhikamau nI nAmamEmi rucirA
    3: drAkSA phalamu kanna nikSurasamu kanna pakSivAha nI nAma rucirA
    4: anjanA tanaya hrtkanja dalamunandu ranjillu nI nAmamEmi rucirA
    5: shrI sadAshivuDumadi sadA bhajincEDi sadAnanda nAma rucirA
    6: sAramu lEni samsAramunaku santArakamagu nAmamEmi rucirA
    7: sharaNanna janamula saraguna rakSincu birudu galgina nAmamEmi rucirA
    8: karirAja prahlAda dharaNIja vibhISaNula gAcina nI nAmamEmi rucirA
    9: kadalI kharjUra phala rasamula-kadhikamu patita pAvana nAmamEmi rucirA
    10: tumburu nAradulu Dambu mIraga gAnambu jEsEDi nAmamEmi rucirA
    11: panasa jambU drAkSA phalarasa sukhakaNTE nadhikamau nI nAma rucirA
    12: rAma bhadrAcaladAma rAmadAsuni prEma nElina nAmamEmi rucirA

    Reply

  420. Posted by Nalini on November 27, 2011 at 1:38 pm

    hello

    i really need the lyrics’ meaning of the Ramadasa keertana”OH Rama Nee NAMA ento ruchira….”
    thank u

    Reply

  421. Posted by Latha on November 24, 2011 at 5:04 am

    Hei madam iam Latha from bangalore i want the lyrics of all songs on Raghavendra Swamy, Hanuman and ayyappa songs sung by Dr. Rajkumar pls do the needful he has sung so many can u pls snd me all the lyrics

    Reply

  422. Vaishnavi: Is there an audio clip available for this song?

    Reply

    • Posted by Vaishnavi Bharadwaj on February 7, 2012 at 5:29 am

      Hello… Sorry for the delayed response.

      Sorry I really tried hard for it.. but couldnt find any.
      I have heared it at 1 of the Guruvara Bhajane in Raghavendra Swamy Mutt.

      Reply

  423. ranganAraka rAjIvalOcana. rAgA: bhUpALa. cApu tALA.

    1: ranganAyaka rAjIva lOcana ramaNa tellavArE lEra
    sangaticE kaNTharasamu nA payyeda kongu tagilinadi lEra
    2: kommalu bangAru kuNDalO pannIru kosi vacciyunnAnu lEra
    sammtitO majjana mADarA nIku kamma kastUri diddEnu lEra
    3: gurulunnagaduvvi koNDayu jaTa vEsi virula sarula juTTe lEra
    tiramuga nI muddumOmuna gurutulu tIrcukondu gAni lEra
    4: kalakaNThulu tALagatula nATyamADi koluva vaccinAnu lEra
    kalakNTi munu gOpAkAntala gUDina kaluvarintalu mAni lEra
    5: tammikolakulanu tummeda panktulu kammu konunnavi lEra
    immaina I rEyi baDalikella dIra iravonda vasarenu lEra
    6: paruvaDi nIdivya uramunandu manci parimaLa maladeda lEra
    pariparui vidhamula pasiDi vINa mITi pADi meppinceda lEra
    7: puvvulacE ninnu pUjinci pogaDanu budhulu vaccinAnu lEra
    avva tercina roTTi AnavAlu venne Aragincu svAmi lEra
    8: angaranga vaibhOga rangayya aruNOdayamAye lEra
    pongali dadhyOdana mAragincanu puNya janAvana lEra
    9: kuluku gubbala munnu komarobbagummina gOpikalu vaccari lEra
    alarmEl manga vEnkaTapati dAsula Adarimpa vEga lEra
    10: lErA nAyayya lErA nA svAmi lErA tellavArE lEra
    lErA ubhaya kAvEri tIra vAsa shrI ranganAyaka lEra

    Reply

    • Posted by Vaishnavi Bharadwaj on February 7, 2012 at 5:39 am

      Hi Lakshman,

      Appreciate your efforts. Thanks a lot.
      But actually this is not the song I am looking for.

      The initial lyrics of the song goes like ” Ranga Nayaka Rajeeva Lochane Ramanane belagaitu ell enutta”

      Reply

      • ಸೋದರಿ, ನನ್ನವಳು ಇತ್ತೀಚೆಗಸ್ಟೇ ಈ ಹಾಡನ್ನು ಮನೆಯಲ್ಲಿ ಭಜನೆ ಮಾಡಿರುತ್ತಾಳೆ. ದಯಮಾಡಿ ಆಲಿಸಿ ನಿಮ್ಮ ಉಪಯುಕ್ತ ಸಲಹೆ ಸೂಚನೆಗಳನ್ನು ಕೊಡಬೇಕಾಗಿ ಕೋರಿಕೆ. http://www.youtube.com/watch?v=uNTxS2KYWO4

  424. Posted by Vaishnavi Bharadwaj on November 21, 2011 at 3:11 am

    HI Meera,

    This is awesome effort input to educate pepl about the Dasaavaani.

    can you plz help me with the lyrics of
    “Yeshtu hellali venkatagiriya, drishtige bahu siriya” and
    “Ranga nayaka rajeeva lochane” songs.

    Plz plz…

    Reply

    • ರಂಗ ನಾಯಕ ರಾಜೀವ ಲೋಚನ ರಮಣನೆ ಬೆಳಗಾಯಿತೇಳೆನುತ
      ಅ೦ಗನೆ ಲಕುಮಿ ತಾ ಪತಿಯನೆಬ್ಬಿಸಿದಳು ಶೃ೦ಗಾರದ ನಿದ್ದೆ ಸಾಕೆನುತ||

      ಸುರರು ಕಿನ್ನರರು ಕಿ೦ಪುರುಷರು ಉರುಗರು ಪರಿಪರಿಯಲಿ ನಿನ್ನ ಸ್ಮರಿಸುವರೋ
      ಅರುಣನು ಬ೦ದು ಉದಯಾ೦ಚಲದಲಿ ನಿ೦ದು ಕಿರಣ ತೋರುವನು ಭಾಸ್ಕರನು ಶ್ರೀ ಹರಿಗೆ||

      ಪಕ್ಷಿರಾಜನು ಬ೦ದು ಬಾಗಿಲೊಳಗೆ ನಿ೦ದು ಅಕ್ಷಿ ತೆರೆದು ಬೇಗ ವೀಕ್ಷಿಸೆ೦ದು
      ಪಕ್ಷಿಜಾತಿಗಳೆಲ್ಲ ಚಿಲಿಪಿಲಿಗುಟ್ಟುತ್ತ ಸೂಕ್ಷ್ಮದಲಿ ನಿನ್ನ ಸ್ಮರಿಸುವರೋ ಕೃಷ್ಣ ||

      ಪದುಮನಾಭನೆ ನಿನ್ನ ನಾಮಾಮೃತವನು ಪದುಮಾಕ್ಷಿಯರು ತಮ್ಮ ಗೃಹದೊಳಗೆ
      ಉದಯದೊಳೆದ್ದು ಸವಿದಾಡುತ್ತ ಪಾಡುತ್ತ ತದಿಯ ಕಡೆವರೆಳೋ ಮಧುಸೂಧನಾ ಕೃಷ್ಣ ||

      ಮುರಗಧರನೆ ನಿನ್ನ ನಾಮದ ಸ್ಮರಣೆಯ ಕರುಣಿಸಬೇಕೆ೦ದು ತರುಣಿಯರು
      ಪರಿ ಪರಿಯಿ೦ದಲಿ ಸ್ಮರಿಸಿಹರೈಪರು “ಪುರ೦ದರ ವಿಠಲ” ನೀ ಏಳೋ ಶ್ರೀ ಹರಿಯೇ||

      Reply

      • Posted by Chitra on May 31, 2012 at 11:28 am

        ಕೃಷ್ಣನನ್ನು ಎಬ್ಬಿಸಲು ಸುಲಭವಾದ ಸುಂದರ ಕನ್ನಡ ಹಾಡನ್ನು ದಯಪಾಲಿಸಿದಕ್ಕೆ ನಿಮಗೆ ಅನಂತ ಅನಂತ ಧನ್ಯವಾದಗಳು .

      • ಸೋದರಿ, ನನ್ನವಳು ಇತ್ತೀಚೆಗಸ್ಟೇ ಈ ಹಾಡನ್ನು ಮನೆಯಲ್ಲಿ ಭಜನೆ ಮಾಡಿರುತ್ತಾಳೆ. ದಯಮಾಡಿ ಆಲಿಸಿ ನಿಮ್ಮ ಉಪಯುಕ್ತ ಸಲಹೆ ಸೂಚನೆಗಳನ್ನು ಕೊಡಬೇಕಾಗಿ ಕೋರಿಕೆ.

      • Posted by meeraghu on June 3, 2012 at 4:58 pm

        Awesome, very nice. Thanks so much for posting the audio and video here.

  425. Posted by Praveen on November 20, 2011 at 3:54 pm

    Hi Charu Garu

    Here it is savemycentsATgmailDOTcom

    Reply

  426. Hi praveen ,

    The requested song in mp3 format. but here its not allowing me to update . if possible give me your mail id so that i can post the song on your mail.

    regards

    charu

    Reply

  427. Meera: I don’t know much kannaDa but I listened to the song and wrote down the lyrics. Plese correct any errors and repost the song lyrics. Thanks.

    ennantha bhaktaru. rAgA: mOhana. t/Adi tALA.

    P: ennantha bhaktaru ananta ninagiharu ninnantha svAmi enagillA
    ninnantha svAmi enagillA adarinda ninnitE ninna salahendu
    C1: patitana nAtharu patitana vAvana nIni ratratna janaka nagapANi
    ratiratna janaka nagapANi nI niralu itara cintyAtO enagiralu
    2: manadoLagE nI niddu manavendanu tIkoNDu manada vrttigaLenna krutisUvi
    manada vrttigaLenna krutisUvi sankarSaNanE ninnA karuNakkE enagANE
    3: nAnA padArthadoLu nAnA prakAradali nIniddu jagavA naDesUvi
    nIniddu jagavA naDesUvi hari nIne nAnembO nanagE gatiyuNTE
    4: ennappA annammA ennayyA ennaNNA ennarasA ennA kuladeiva
    ennarasA ennA kuladeiva ihaparadu ennA biTTagaladE irukaNDyE
    5: anAtha bandhu jagannAtha viThala sapanna paripAla mAlOlA
    sapanna paripAla mAlOlA harikAnca janyAdhrtapANi salahemmA

    Reply

  428. Th eaudio is available here:

    http://ishare.rediff.com/music/kannada-devotional/ennantha-bhaktaru-anantha-ninagiharu/10036595

    If you figure out th lyrics please post them here. Thanks.

    Reply

  429. Posted by Vanishree on November 18, 2011 at 7:02 am

    Hi Meera,

    Do you have lyrics of song “Ennantha Bhaktaru anantha ninagiharu ninnantha swamy yenagilla” written by Jagannatha Dasaru?

    Reply

  430. Hi praveen ,

    which songs link you meant for ??

    Reply

  431. Hi

    Famous song by Purandara dasar sung by Puttlur narasimha nayak.

    Venunatha baaro
    ==============

    Venunatha baaro venkata ramanane baaro
    baanana banghisi thantha bhavajayyane baaro (venunatha)

    Bhoothaniya moleyunda navaneetha chorane baaro
    bheetha raavanana samharisidha seetha nayaka baaro ( venunatha)

    billa murithu mallara ghetha pulla nabhane baaro
    kollathe rodana naliva cheluva mooruthi baaro (venunatha)

    mandhara giri yethhi thantha indire ramanane baaro
    kundhadhe govugala kaydha pundari kakshane baaro (venunatha)

    nariya ramnike poguva vaarija naabane baaro
    eerelu bhuvanava kayuva mara nayyane baaro (venunatha)

    sheshayana mooruthiyadha vasudhevane baaro
    dasarolu dasanadha purandhara vittala baaro (venunatha)

    regards

    charu

    Reply

    • Posted by Praveen on November 17, 2011 at 9:28 am

      Thanks Charu ji,

      Do you by any chance have link to audio of the song so that we can listen. Appreciate your effort.

      Reply

  432. hi veena ,

    please find the lyrics of Kapadu sri sathya narayana..

    kaapadu sri sathyanarayana
    bannaga shayan baavana charana nambidhe ninna ( kaapadu )

    narayana lakshmi narayana
    narayana sathya narayana
    manavembo mantapa belagagidhe
    hari namadha manthrava thumbidhe
    ee maneyu neeniruva gudiyagli
    sukha shanthi nimmathiyu neleyagali ( kaapadu)

    nanagaki yenenthu naabeduve
    dhanakanaka bekenthu naakeluve
    yenthenthu sthiravaagi neeilligu
    nannalli onthagi usirahiru (kaapadu )

    panneera abisheka naamaduve
    karuneya nee yenna kaapaadithe
    karuthatha parikara naa maadithe
    naagaanandha nee needithe ( kaapadu )

    regards
    charu

    Reply

  433. hi chandrika

    please find the song which you requested long back sung by Dr.Rajkumar.

    Guruvaara banthamma guru vaara banthamma
    rayara nenayamma guru rayara neneyamma
    smarana marthradhali glesha kaledhu sathgathiya koduvanamma (guru)

    yogi baruva namma subha yoga baruvuthamma
    raghavendra guru raja bandhu bhava roga kalevanamma (guru)

    manava tholeyaramma bhakthiya maneye haaki ramma
    dyanadhindha karedhaki bandhu holegenna berevanamma (guru)

    kopa ariyanamma yaaranu dhoora thalla numma
    preethi mathike sothu baruva maguvanthe kaaniramma (guru)

    hindhe baruvanamma rayara nerelindha hanumaa
    hanuma nithade sri rama nithu nija mukthi koduvanamma ( guru)

    cheers

    charu

    Reply

  434. Hi ,
    Am recently come to know about this site … its much appreciable that everyone can share slokhas, lyrics etc….

    here i found the lyrics of Vittala dasa’s one of the famous song…

    Baaro namma manege sri raghavendra baaro namma manege
    Baaro dhukkadipara baaro dhuritha dhoora baaraiya shanmarga dhari thoruva gurve (baaro )

    Vyasa nirmitha grantha madhwa kritha bhasyava besara dheyothi merava vyasa muniye(baaor)

    Manthra hredhali nintha suyathi varyane anthara thiliyatho nee anthara dholu (baaro)

    Bhootha pretha gala kyathisi bidu vantha kyathi udaryathi nathane stuthi suve (baaro)

    Khusta rogadhigala nastamaduvanta asta mahimayutha shresta muniye (baaro)

    Karadhare bharuvi yembo keeruthi kelina karethanu karunadhi karava pididhe yenthu (baaro )

    Bhakthavatsalanemba birudhi nindhadhara sathsanamore kele madhwesha vittala dasa (baaro)

    Reply

  435. Hi ,
    Am recently come to know about this site … its much appreciable that everyone can share slokhas, lyrics etc….

    here i found the lyrics of Vittala dasa’s one of the famous song…

    Baaro namma manege sri raghavendra baaro namma manege
    Baaro dhukkadipara baaro dhuritha dhoora baaraiya shanmarga dhari thoruva gurve (baaro )

    Vyasa nirmitha grantha madhwa kritha bhasyava besara dheyothi merava vyasa muniye(baaor)

    Manthra hredhali nintha suyathi varyane anthara thiliyatho nee anthara dholu (baaro)

    Bhootha pretha gala kyathisi bidu vantha kyathi udaryathi nathane stuthi suve (baaro)

    Khusta rogadhigala nastamaduvanta asta mahimayutha shresta muniye (baaro)

    Karadhare bharuvi yembo keeruthi kelina karethanu karunadhi karava pididhe yenthu (baaro )

    Bhakthavatsalanemba birudhi nindhadhara sathsanamore kele madhwesha vittala dasa (baaro)

    Reply

  436. Posted by sujatha on November 8, 2011 at 9:17 pm

    Hi,
    I am looking for JAGANNATHA DASARU’S LAKSHMI HRUDAYA, it is in kannada, it starts like “sri manohare lakumi thava pada”. I hear this sung by puttur narasimha nayak, it is very nice.

    sujatha.

    Reply

  437. Posted by Praveen on November 2, 2011 at 10:22 am

    Namaskara

    Can you please post lyrics in English for Namah Paarvathi pathi by Sri Vyasa theertharu

    Reply

  438. Well done, I read it two times

    Reply

  439. shatashloi ramayana available excellent video please watch all members.
    Link is here
    http://www.puttugam.com/PuttuGam/Home.html

    Reply

  440. Om Sai Ram
    namaskaarams

    all members of this website please chant shata sloki ramayana / sankshepa ramayanam it is a very power full tool for all problems solver, excellent results good for health and wealth.

    srinivasan

    Reply

  441. Posted by Leela on October 24, 2011 at 4:03 am

    Hi Please mail me the Nandhi kavasam in Tamil.

    My id is leela191966@gmail.com
    Leela

    Reply

  442. Posted by Srilatha prakash on October 21, 2011 at 1:59 pm

    Hi meera can you please upload the song narayana ninna namada smarane.

    Reply

  443. Posted by Naveen Agastya on October 19, 2011 at 1:45 am

    🙂 Meera avarige nanna namaskaaragalu.
    no words to describe u as for the hard work u r doing for the people’s requirement..
    hruthpoorvaka vandane abhinandane galu nimage taayi..
    can u plz mail me the lyrics (kannada or english )of “Kamakshi Mangala Shasana”
    that is “Chakra rajasthithe chakra vaalanvithe vakra vaagvandite vikramanandite”
    I heartily dedicate this song to u 🙂

    Reply

  444. jaya janArdana krSNa rAdhikA patE
    jana vimOcana krSNa janma mOcana
    garuDa vAhana krSNa gOpikApatE
    nayana mOhana krSNa nIrajEkSaNa

    sujana bAndhava krSNa sundarakrtE
    madana kOmala krSNa mAdhava harE
    vasumati patE krSNa vasavanuja
    varaguNakara krSNa vaishNavakrtE
    suruciranana krSNa shauryavAridE
    murahara vibhO krSNa muktidAyaka
    vimalapAlaka krSNa vallabhipatE
    kamalalOcana krSNa kAmyadAyaka

    vimalagAtranE krSNa bhaktavatsalA
    caraNa pallavam krSNa karuna kOmalam
    kuvalaikSaNa krSNa kOmalAkrtE
    tava padAmbujam krSNa sharaNamAshrayE
    bhuvana nAyaka krSNa pAvanakrtE
    guNagaNojvala krSNa nalinalOcana
    praNayavAridhE krSNa guNagaNakara
    damasOdara krSNa dIna vatsalA

    kAmasundara krSNa pAhi sarvadA
    narakanAshana krSNa narasahAyaka
    dEvaki suta krSNa kAruNyambudE
    kAmsa nAshana krSNa dvAraksthita
    pavanAtmaka krSNa dEhi mangaLam
    tvatpadAmbujam krSNa shyama kOmalam
    bhaktavatsala krSNa kamyadAyaka
    pAlisennanu krSNa shrIhari namO

    bhaktadAsa nA krSNa harasu nI sadA
    kadu nintena krSNa salaheya vibhO
    garuDa vAhan krSNa gOpikapatE
    nayana mOhana krSNa nIrajEkSaNa

    Reply

  445. Thankyou very much, I am extremely thankful to you. To be frank I started getting intrest in slokas and devotional songs after I went through this website.

    Reply

  446. The lines ar a little tricky to read since it uses the Harvard formatting system. I got this off the net:

    OM mathsyAya namaH:

    proshhThIsha vigraha sunishhThiiva noddhata vishishhTAMbuchAri jaladhe |
    koshhTha.ntarAhita vicheshhTAgamaugha parameshhThIDitattvamavamAm.h |
    preshhThArkasUnumanu jeshhThArthamAtmavidatIshhTo yugA.nta samaye |
    stheshhThAtma shR^iN^gadhR^ita kAshhThAmbuvAhana varAshhTA padaprabha tano ||1||
    OM sri HayagrIvaya namaH
    khaNDIbhavadbahuLaDinDIrajR^imbhaNa suchaNDI kR^ito dadhi mahA |
    kANDAti chitra gati shauNDAdya haimarada bhANDA prameya charita |
    chaNDAshvakaNThamada shuNDAla durhR^idaya gaNDA bhikhaNDAkara do |
    shchaNDA mareshahaya tuNDAkR^ite dR^ishama khaNDA malaM pradisha me ||2||
    OM kUrmAya namaH
    kUrmAkR^ite tvavatu narmAtma pR^ishhThadhR^ita bharmAtma ma.ndara gire |
    dharmAvalaMbana sudharmA sadAMkalita sharmA sudhAvitaraNAt.h |
    durmAna rAhumukha durmAyi dAnavasumarmA bhibhedana paTo |
    dharmArka kAnti vara varmA bhavAn.h bhuvana nirmANa dhUta vikR^itiH || 3||
    OM dha.nva.ntharE namaH
    dhanva.ntare.aN^garuchi dha.nva.ntareritaru dha.nva.nstarIbhavasudhA |
    bhAnva.ntarAvasatha manvantarAdhikR^ita tanva.ntaraushhadhanidhe |
    da.nva.ntaraN^gashubudanva.ntamAjishuvi tanvanmamAbdhi tanayA |
    sUnvantakAtmahR^idata.nvarAvayava tanva.ntarArtijaladhau || 4||
    OM srI nArAyaNayaI namaH
    yAxIravArdhimadanAxINadarpaditijAxobhitAmaragaNA |
    pexAptaye.ajanivalaxAMshhubiMbajidatIxNAlakAvR^itamukhI |
    sUxmAvalagnavasanAxepakR^itkucha kaTAxAxamIkR^itamano |
    dIxAsurAhR^itasudhAxANino.avatusu rUxexaNAddharitanuH || 5||
    OM srI narAyaNayaI namaH
    shixAdiyunnigama dIxAsulaxaNa parixAxamAvidhisatI |
    dAxAyaNI xamati sAxAdramApinaya dAxepavIxaNavidhau |
    prexAxilobhakaralAxAra soxita padAxepalaxitadharA |
    sAxiritAtmatanu bhUxArakAriniTilAxAxamAnavatu naH || 6||
    OM srI varAhAya namaH
    nIlAmbudAbhashubha shIlAdridehadhara khelAgR^itodhadhidhunI |
    shailAdiyukta nikhilelA kaTAdyasura tUlATavIdahana te |
    kolAkR^ite jaladhi kAlAchayAvayava nIlAbjadaMshhTra dhariNI |
    lIlAspadorutara mUlAshiyogivara jAlAbhivandita namaH || 7||
    OM srI narasI.mhAya namaH
    daMbholitIxNanakha saMbheditendraripu kuMbhIndra pAhi kR^ipayA |
    staMbhArbha kAsahanaDiMbhAya dattavara gaMbhIra nAda nR^ihare |
    aMbhodijAnusaraNAMbhojabhUpavana kuMbhIna sesha khagarAT.h |
    kuMbhIndra kR^ittidhara jambhAli shhaNmukha mukhAMbhoru hAbhi nuta mAm.h ||8||
    OM srI vAmanAya namaH
    piN^gAxa vikrama turaN^gAdi sainya chaturaN^gA valipta danuja |
    sAN^gA dhvarastha bali sAN^gAvapAta hR^ishhitAN^gA marAlinuta te |
    shR^iN^gAra pAdanakha tuN^gAgrabhinna kana kAN^gANDapatti taTinI |
    tuN^gAti maN^gala taraN^gA bhibhUta bhaja kAN^gAgha vAmana namaH || 9||
    ON srI vAmanAya namaH
    dhyAnArha vAmana tanonAtha pAhi yajamAnA sureshavasudhA |
    dAnAya yAchanika lInArtha vAgvashita nAnAsadasya danuja |
    mInAN^ka nirmala nishAnAtha koTila samAnAtma mauJNjiguNakau |
    pInAchchha sUtrapada yAnAta patrakara kAnamyadaNDavarabhR^it.h || 10||
    OM srI parashurAmAya namaH
    dhairyAmbudhe parashucharyAdhikR^ittakhala varyAvanIshvara mahA |
    shauryAbhibhUtakR^ita vIryAtmatajAbhuja vIryAvalepanikara |
    bhAryAparAdhakupitAryAGYayAgalitanAryAtma sUgala taro |
    kAryAparAdhamavichAryArya maughajayi vIryAmitA mayi dayA || 11||
    OM srI rAmAya namaH
    shrIrAmalaxmaNashukArAma bhUravatugaurAmalAmitamaho |
    hArAmarastuta yashorAmakAntisuta norAmanorathahara |
    svArAmavaryaripu vIrAmayArdhikara chIrAmalAvR^itakaTe |
    svArAma darshanajamArAmayAgatasughorAmanoramalabdhakalaha || 12||
    OM srI rAmAya namaH
    shrIkeshavapradishanAkesha jAtakapilokesha bhagnaravibhU |
    stoketarArtiharaNAkevalArtasukhadhIkekikAlajalada |
    sAketanAthavarapAkeramukhyasuta kokena bhaktimatulAm.h |
    rAkendu biMbamukha kAkexaNApaha hR^ishIkesha te.aN^ghrikamale || 13||
    OM srI rAmAya namaH
    rAmenR^INAM hR^idabhirAmenarAshikula bhImemanodyaramatAm.h |
    gomedinIjayitapomeyagAdhisuta kAmenivishhTa manasI |
    shyAme sadA tvayijitAmeya tApasaja rAme gatAdhikasame |
    bhImeshachApadalanAmeyashauryajita vAme xaNe vijayinI || 14||
    OM srI sItAsvarUpINaI shhrIyai namaH
    kAntAragehakhala kAntAraTadvadana kAntAlakAntakasharam.h |
    kAntArayAmbujani kAntAnvavAyavidhu kAntAshmabhAdipahare |
    kauntAliloladala kAntAbhishobhitila kAntAbhava.ntamanusA |
    kAntAnuyAnajita kAntAradurgakaTa kAntAramAtvavatu mAm.h || 15||
    OM srI rAmAya namaH
    dAntaM dashAnana sutA.ntaM dharAmadhivasa.ntaM prachaNDa tapasA |
    klA.ntaM sametya vipinA.ntaM tvavApa yamana.ntaM tapasvi paTalam.h |
    yAntaM bhavArati bhayAntaM mamAshu bhagava.ntaM bhareNa bhajatAt.h |
    svA.ntaM savAri danujA.ntaM dharAdharaNishAntaM sa tApasavaram.h || 16||
    OM srI rAmAya namaH
    shaMpAbhachApalava kaMpAsta shatrubala saMpAditAmitayashAm.h |
    shaM pAda tAmarasa saMpAti nola manu kaMpAra sena dishame |
    saMpAti paxi sahajaMpApa rAvaNa hataM pAvanaM yada kR^ithAH |
    tvAM pApa kUpa pati taM pAhi mAM tadapi paMpA sarasta Tachara || 17||
    OM srI rAmAya namaH
    lolAxyapexitasulIlAkuraN^gavada khelAkutUhala gate |
    svAlApabhUmijanibAlApahAryanuja pAlAdyabho jaya jaya |
    bAlAgnidagdhapura shAlAnilAtmajani phAlAttapattalarajo |
    nIlAN^gadAdikapi mAlAkR^itAlipatha mUlAbhyatIta jaladhe || 18||
    OM srI rAmAya namaH
    tUNIrakArmukakR^ipANIkiNAN^kabhuja pANI ravipratimabhAH |
    xoNibhapattinubha ghoNI mukhAdighanaveNIsuraxaNakaraH |
    shoNibhavannayana koNI jitAmbunidhi pANI ritArhaNamaNI |
    shreNIvR^itAN^ghririha vANIshasUnuvara vANIstuto vijayate || 19||
    OM srI rAmAya namaH
    huN^kArapUrvamataTaN^kAranAdamati paN^kAvadhArya chalitA |
    laN^kAshilochchayavishaN^kA padadbhidura shaN^kAshhayasya dhanushhaH |
    laN^kAdhipomanutayaN^kAlarAtrimiva shaN^kAshatAkuladhiyA |
    taN^kAladaNDashata saN^kAshakArmukha sharAN^kAnvitaM bhaja harim.h || 20||
    OM srI rAmAya namaH
    dhImAnameyatanujApANDabhUdhashashajapAMbujAti suhR^idAm.h |
    kAmAripannagapa kAmAhi vairiguru somAdivandya mahima |
    sthemAdinApagata sImAvatAtsakhala sAmAja rAvaNaripU |
    rAmAbhido harirabhaumAkR^itiH pratana sAmAdi vedavishhayaH || 21||
    OM srI rAmAya namaH
    doshhAtmabhUvashaturAshhADatikramaja doshhAtmabhartR^ivachasa |
    pAshhANabhUtamuniyoshhAvarAtmatanuveshAdidAyicharaNaH |
    naishhAdhayoshhidhasubheshhAkR^idaNDajani doshhAcharAdi suhR^ido |
    doshhAgrajanmamR^itishoshhApaho.avatu sudoshhAN^ghrijAtahananAt.h || 22||
    OM srI kR^ishnAya namaH
    vR^i.ndAvanasthapashu vR^i.ndAvanaM vinuta vR^i.ndArakaikasharaNam.h |
    na.ndAtmajaM nihata ni.ndA kR^idA surajanandAmabaddha jaTharam.h |
    vandAmahe vayama mandAvadAtaruchi mAndAxakArivadanam.h |
    kundAlidantamuda kandAsitaprabhatanu.ndAvarAxasaharam.h || 23||
    OM srI kR^ishnAya namaH
    gopAlakotsavakR^itApArabhaxarasa sUpAnnalopakupitA |
    shApAlayApitalayApAMbudAlisalilApAyadhAritagire |
    sApAN^gadarshanajatApAN^ga rAgayuta gopAN^ga nAMshuka hR^iti |
    vyApAra shauNDavividhApAya tatsvamava gopArijAtaharaNa || 24||
    OM srI kR^ishnAya namaH
    kaMsAdikAsadavataMsA vanIpativihiMsAkR^itAtmajanushham.h |
    saMsArabhUtamiha saMsArabaddhamana saMsArachitsukhatanum.h |
    saMsAdhaya.ntamanishaMsAttvikavratamahaMsAdaraM bata bhaje |
    haMsAditApasariraMsAspadaM paramahaMsAdi vandya charaNaM || 25||
    OM srI kR^ishnAya namaH
    rAjIva netravidurAjIvamAmavatu rAjIva ketanavasham.h |
    vAjIbhapattinR^ibharAjI rathAnvitaja rAjIva garvashamana |
    vAjIshavAhasita vAjIsha daitya tanu vAjIsha bhedakaradoH |
    jAjIkadaMbanava rAjIva mukhyasuma rAjIsuvAsitashiraH || 26||
    OM srI kR^ishnAya namaH
    kAlIhR^idAvasatha kAlIyakuNDalipa kAlIsthapAdanakhara |
    vyAlInavAMshukara vAligaNAruNita kAlIruche jaya jaya |
    kelIlavApahR^ita kAlishadattavara nAlIkatR^iptaditibhU |
    chUlIkagopamahilAlItanUghusR^iNadhUlIkaNAN^kahR^idaya || 27||
    OM srI kR^ishnAya namaH
    kR^ishhNAdi pANDusuta kR^ishhNA manaHprachura tR^ishhNA sutruptikaravAk.h |
    kR^ishhNAN^kapAlirata kR^ishhNAbhighAghahara kR^ishhNAdishhaNmahiLa bhoH |
    pushhNAtu mAmajita nishhNAda vArdhimuda nushhNAMshu maNDala hare |
    jishhNo girIndra dhara vishhNo vR^ishhAvaraja ghR^ishhNo bhavAnkaruNaya ||28||
    OM srI kR^ishNaya namaH
    rAmAshiromaNidharAmAsametabalarAmAnujAbhidharatim.h |
    vyomAsurA.ntakara te mAratAta dishame mAdhavAN^ghrikamale |
    kAmArtabhaumapura rAmAvalIpraNaya vAmAxipItatanubhA |
    bhImAhinAthamukhavaimAnikAbhinuta bhimAbhivandya charaNa || 29||
    OM srI kR^ishNAya namaH
    saxveLabhaxyabhaya dAxishravo gaNaja lAxepapAshayamanam.h |
    lAxAgR^ihajvalana raxo hiDimbabaka bhaixAnnapUrvavipadaH |
    axAnuba.ndhabhavarUxAxarashravaNa sAxAnmahishhyavamati |
    kaxAnuyAnamadhamaxmApasevanamabhIxNApahAsamasatAm.h || 30||
    chaxANa evanija paxAgrabhUdhashashhadAxAtmajAdi suhR^idAm.h |
    AxepakArikunR^ipAxauhiNIshajabalAxobhadIxitamanAH |
    tArxyAsichApasharatIxNAripUrvanija laxmANichApyagaNayan.h |
    vR^ixAlayadhvajariraxAkaro jayati laxmIpatiryadupatiH || 31||
    OM srI bhuddhAya namaH, OM srI kalkIne namaH
    buddhAvatArakavi baddhAnukaMpakuru baddhAJNjalau mayi dayAm.h |
    shauddhodanipramukha saiddhAntikA sugama bauddhAgamapraNayana |
    kruddhAhitAsuhR^itisiddhAsikheTadhara shuddhAshvayAnakamalA |
    shuddhAntamAMruchipi maddhAkhilAN^ga nija maddhAva kalkyabhidha bhoH || 32||
    OM srI badari nArAyana namaH
    sAraN^ga kR^ittidhara sAraN^ga vAridhara sAraN^ga rAjavaradA |
    sAraN^ga dAritara sAraN^ga tAtmamada sAraN^gataushhadhabalam.h |
    sAraN^ga vatkusuma sAraN^ga taJNchatava sAraN^ga mAN^ghriyugalam.h |
    sAraN^ga varNamapa sAraN^ga tAbjamada sAraN^ga diMstvamava mAm.h || 33||
    ma^nGAlA charana
    grIvAsya vAhatanu devANDajAdidasha bhAvAbhirAma charitam.h |
    bhAvAtibhavyashubha dIvAdirAjayati bhUvAgvilAsa nilayam.h |
    shrIvAgadhIshamukha devAbhinamya harisevArchaneshhu paThatAm.h |
    AvAsa evabhavitAvAgbhavetarasurAvAsalokanikare || 34||
    iti shrImadvAdirAjapUjyacharaNa virachitaM
    shrIdashAvatArastutiH saMpUrNam.h

    … bhAratIramaNamukhyaprANA.ntargata shrIkR^ishhNArpaNamastu

    Reply

  447. I have finding for the lyrics of Dasavathara sthuthi(protisha vighra) by vadirajaru from long if possible in English or sanskrit.Please help me as I searched all the websites and also leading bookshops at B’lore and chennai.

    Reply

  448. Posted by sanchita on September 19, 2011 at 10:01 pm

    Plesae send me the meaning of tamil song “JAYA JAYA DEVI JAYA JAYA DEVI DURGA SARANAM ” by P suessela in englsh. Because I m bengali and I do not know tamil language.

    Reply

  449. Posted by Ranjana on September 18, 2011 at 8:34 pm

    Namaste,

    We are looking for lyrics of ‘Hanumanta Hanumanta’ sung by Raichur Sheshgiridas.
    Could you please post one on your website or let us know where we can get the same?

    Thanking you for your help.

    Reply

  450. kaNDu kaNDu nIyenna. rAgA: mOhana. khaNDacApu tALA.

    P: kaNDu kaNDu nIyenna kaiya biDuvare puNDarIkAkSa puruSOttama harE
    C1: bandhugaLu enagilla badukinali sukhavilla nindeyali nondenai nIrajAkSa
    tande tAyiyu nInE bandhu baLagavu nInE endendigU ninna nambideno krSNa
    2: kSaNavondu yugavAgi trNakinta kaDeyAgi eNisalArada bhavadi nonde nAnu
    sanakAdi muni vandya vanaja sambhava janaka phaNishAyi prahlAdagolida shrI krSNa
    3: bhaktavatsalanemba biruda pottA mEle bhaktarAdhInanAgira bEDavE
    mukti dAyaka nInu honnUru puravAsa shakta guru purandara viTTala shrI krSNa

    Reply

  451. Posted by Sunitha on September 16, 2011 at 11:08 am

    Can u please let me know the lyrics of Kandu Kandu nee ena kai beduveya krishna…

    Thanks

    Reply

  452. Posted by Harish on September 7, 2011 at 6:12 am

    I want Entha andha Entha chanda sharadamba lyrics in English, Please provide me. The song is sung br Dr. Rajkumar

    Reply

  453. Posted by Nandini on September 6, 2011 at 6:52 am

    Hi Meera,

    I have learnt a great lot of things from your blogs. I am too a staunch devotee of rayaru. Recently when i went to mantralya, during the pooja they sung a song “smarisu gurugala manave”. Its a very nice song. can you please post the lyrics of this song if you can??? It will be a great help. Thanks My id: nandinivekananda@gmail.com

    Reply

  454. Posted by sudha acharya on August 31, 2011 at 7:25 am

    Meera madam,

    I wnat to know, you have the kannada lyrics of Sri Vadiraja Kavacha song – smarane madiro sode vadirajara. Please inform or send it.

    Reply

  455. Posted by amma on August 31, 2011 at 2:32 am

    This site has Dakhinamurthy stotras 2 or three different ones. Need Telugu font to read

    http://www.shaivam.org/ste.htm
    Here is the PDF from that site
    http://www.shaivam.org/telugu/ste_sk_daxina.pdf

    Reply

  456. Posted by Veena Bheemesh on August 30, 2011 at 9:12 am

    With regards,,
    Veena
    Bangalore

    Reply

  457. Posted by Veena Bheemesh on August 30, 2011 at 9:11 am

    Meera Madam,

    Can you load mangala gowri story in kannada please…

    Reply

  458. Posted by kameshwararao on August 29, 2011 at 10:16 am

    need tulasi kavacham n medha dakshinamurthy stotram in telugu

    Reply

  459. Posted by kameshwararao on August 29, 2011 at 10:10 am

    need panchamukha anjenaya stotram in telugu

    Reply

  460. Posted by Ashwini Kulkarni on August 22, 2011 at 6:05 pm

    Hi Mam,

    Thank you very much for building such a website.I got many songs lyrics correctly. I am feeling very happy today as i got so many songs lyrics in a single website. Its very useful one keep going. Good job & good site.

    I have a request, can u upload some other lord shiva, lord ganesha & goddess gowri songs. It will be a great help.

    Regards

    Ashwini

    Reply

  461. Posted by Praveen on August 16, 2011 at 3:32 am

    Fantastic site thanks a lot , can you upload lyrics for Gopika Geetha (Jayathi JayathiKam) thank you -rgds
    Praveen

    Reply

  462. Posted by Rajesh.S on August 11, 2011 at 12:30 pm

    The site is fantastic.. Loved it.. n youngsters like me who luv to chant … this site seems to be very usefull

    Reply

  463. Posted by Priya Nagarajan on August 10, 2011 at 3:16 am

    Can you please send the lyrics of govinda namo govinda namo narayana which is sung by Vidyabhushana and also of yeh savi yeh yeh savi hari nama sung by Sheshagiridasaru..

    Reply

    • gOvindA namO. rAgA: Anandabhairavi. tripuTa tALA.

      P: gOvindA namO gOvindA namO gOvindA nArAyaNa
      gOvardhana giriyanettida gOvindA namma rakSisai
      C1: manca bAradu maDadi bAraLu kancu kannaDi bAradu
      sancitArthada dravya bAradu munce mADida dharmave
      2: arthavyArige putraryArige mitra bAndhavaryArige
      kartu yamanavareLedu oivAga artha putraru kAivare
      3: tandu bandare tanna puruSana hasidu baLalidirembaLu
      ondu divasavu tAradiddare handi nAyante keLevaLu
      4: prANa vallabhe tanna puruSana kANade nillalAraLu
      prANa hOgalu muTTalanjvaLu jANe karedaru bAraLu
      5: uNTu kAlake neNTariSTaru baNTarAgi kAivaru
      kaNTakemanOru bandu eLevAga neNTariSTaru bAraru
      6: oDeveyarasige oDalu agnige maDadi mattobba celuvage
      baDideLedu yamanavaru oivAga eDavi bidditu nAlige
      7: diTTatanadi puTTanALida vrSTinandana caraNava
      muTTi bhajisiro siri purandara viTTalEshana pAdava

      Reply

  464. Posted by Rama on August 8, 2011 at 1:03 pm

    I am looking for an MP3 download for Vani Jayaram’s Dheera Gambhira Mangalam son from – Sri Durgabhavani Strotram CD. Can you please help me?

    Reply

  465. Posted by LAKSHMI SUDHEER on August 5, 2011 at 1:01 am

    HI I NEED LYRICS OF KAMALADA MOGADOLE,KAMLADA KANNOLE SONG AND MAHALAKSHMI MANGEGE BARAMMA FROM KANNADA MOVIES

    Reply

  466. Posted by Pramitha Lakshmi on August 4, 2011 at 12:02 am

    thanks a lot!!!

    Reply

  467. hi can please post mangala gowri pooja vidhana and story in detail

    Reply

  468. Posted by K.Harini on August 1, 2011 at 2:05 pm

    Dear Madam,
    This is Harini and i stay in Mexico.Have u heard about “aidu sukravaara haadu”,”sravana sanivaarda haadu”..I have that book in kannada,but I want it in English.can u help me in any way?

    Regards,
    Harini.

    Reply

  469. Posted by Pramitha Lakshmi on August 1, 2011 at 12:30 am

    Hi,

    Can u please upload the lyrics of kankadhara stotram in malayalam.?

    Regards
    lakshmi

    Reply

  470. Posted by Puneeth on July 27, 2011 at 12:58 pm

    This is just so helpful. I’m very grateful for this collection.

    Thank you so much!
    Puneeth

    Reply

  471. Posted by Umesh on July 20, 2011 at 10:40 am

    Thanks a lot for Sharing.

    Regards,
    Umesh

    Reply

  472. Posted by amma on July 20, 2011 at 2:00 am

    ಹನುಮಾನ್ ಪೂವ೯ತಃ ಪಾತು ದಕ್ಷಿಣೇ ಪವನಾತ್ಮಜಃ
    ಪ್ರತೀಚ್ಯಾಂ ಪಾತುರಕ್ಷೋಙ ಉತ್ತರಸ್ಯಾಭ್ಧಿಂ ಪಾರಗಃ ।। ೧ ।।

    ಉದೀಚ್ಯಾಂ ಊದ್ವ೯ಗಃ ಪಾತು ಕೇಸರೀ ಪ್ರಿಯನಂದನಃ
    ಅಧಃಶ್ಚ ವಿಷ್ಣು ಭಕ್ತಸ್ತು ಪಾತು ಮದೆ್ಯೕತು ಪಾವನಿ ।। ೨ ।।

    ಅವಾಂತರ ದಿಶಃ ಪಾತು ಸೀತಾಶೋಕವಿನಾಶನಃ
    ಲಂಕಾವಿದಾಹಕಃ ಪಾತು ಸವಾ೯ಪದ್ ಭ್ಯೋ ನಿರಂತರಂ ।। ೩ ।।

    ಸುಗ್ರೀವ ಸಚಿವಪಾತು ಮಸ್ತಕಂ ವಾಯುನಂದನಃ
    ಭಾಲಂ ಪಾತು ಮಹಾವೀರೋ ಭ್ರುವೊರ್ಮಧ್ಯೇ ನಿರಂತರಂ ।। ೪ ।।

    ನೀತ್ರೇ ಛಾಯಾಪಹಾರೀ ಚ ಪಾತು ನಃ ಪ್ಲವಗೇಶ್ವರಃ
    ಕಪೊಲೌ ಕಣ೯ಮೂಲೇ ಚ ಪಾತು ಶ್ರೀರಾಮ ಕಿಂಕರಃ ।। ೫ ।।

    ನಾಸಾಗ್ರಮ್ ಅಂಜನೀಸೂನುವ೯ಕ್ತ್ರಂ ಪಾತು ಕಪೀಶ್ವರಃ
    ವಾಚಂ ರುದ್ರಪಿ್ರಯ ಪಾತು ಜಿಹ್ವಾಂ ಪಿಂಗಳ ಲೋಚನಃ ।। ೬ ।।

    ಪಾತು ದಂತಂ ಫಲ್ಗುಣೇಷ್ಟ ಸ್ಚುಂಬಕಂ ದೈತ್ಯ ಪ್ರಾಣಹೃತ್
    ಪಾತು ಕಂಠಶ್ಚ ದೈತ್ಯಾರಿಃ ಸ್ಕನ್ದೌ ಪಾತು ಸುರಾ೯ಚಿ ತಃ ।। ೭ ।।

    ಭುಜೌ ಪಾತು ಮಹಾ ತೇಜಾಃ ಕರೌತು ಚರಣಾಯುಧಃ
    ನಖಾಂನಖಾಯುಧ ಪಾತು ಕುಕ್ಷಿಂ ಪಾಕು ಕಪೀಶ್ವರಃ ।। ೮ ।।

    ವಕ್ಷೋ ಮುದ್ರಾಪಹಾರೀ ಚ ಪಾತು ಪಾ೯ಶೆ್ವೕ ಭುಜಾಯುಧಃ
    ಲಂಕಾವಿಭಂಜನಃ ಪಾತು ಪೃಷ್ಟದೀಶೀ ನಿರಂತರಂ ।। ೯ ।।

    ನಾಭಿಂ ಚ ರಾಮಧೂತೋಸು್ತ ಕಟಿಂ ಪಾತು ನಿಲಾತ್ಮಜಃ
    ಗುಹ್ಯಂ ಪಾತು ಮಹಾ ಪ್ರಾಜ್ಞಃ ಲಿಂಗಂ ಪಾತು ಶಿವಪ್ರಿಯಃ ।। ೧೦ ।।

    ಊರೂ ಚ ಜಾನುನೀ ಪಾತು ಲಂಕಾ ಪ್ರಾಸಾದ ಭಂಜನಃ
    ಜಂಗೇ ಪಾತು ಮಹಾಬಾಹು ಗುಲ್ಪೌ ಪಾತು ಮಹಾಬಲಃ ।। ೧೧ ।।

    ಅಚಲೋ ದಾ್ವರಕಃ ಪಾತು ಪಾದೌ ಭಾಸ್ಕರ ಸನ್ನಿಭಃ
    ಅಂಜನೀಸುತ ಸತಾ್ವಢ್ಯಃ ಪಾತು ಪಾದಾಂಗುಲೀಸ್ತಥಾ ।। ೧೨ ।।

    ಸ೯ವಾಂಗಾನಿ ಮಹಾವೀರಃ ಪಾತು ರೋಮಾಣಿ ಚಾತ್ಮವಾನ್
    ಹನುಮತ್ಕವಚಂ ಯಸ್ತು ಪಠೇದಿ್ವದಾ್ವನ್ ವಿಚಕ್ಷಣಃ ।। ೧೩ ।।

    ಶ್ರೀರಾಮಾದಾಗ್ರೇ ಹನುಮದಾಗ್ರೇ ಯಃ ಪಠೇಚ್ಚ ನರಃ ಸದಾ
    ಸಏವ ಪುರುಷಶ್ರೇಷ್ಟೋ ಭಕಿ್ತಂ ಮುಕ್ತಿಂ ಚ ವಿಂದತಿ ।। ೧೪ ।।

    ತ್ರಿಕಾಲಂ ಏಕಕಾಲಂವಾ ಪಠನ್ಮಾಸ ತ್ರಯಂ ನರಃ
    ಸವಾ೯ನ್ ರಿಪೂನ್ ಕ್ಷಣಾತ್ ಜಿತ್ವಾ ಸಪುಮಾನ್ ಶ್ರಿಯಂ ಆಪ್ನುಯಾತ್ ।।೧೫ ।।

    ಮಧ್ಯರಾತ್ರೇ ಜಲೇ ಸ್ಥಿತ್ವಾ ಸಪ್ತವಾರಂ ಪಠೇತ್ಯ ಯದಿ
    ಕ್ಷಯ ಅಪಸ್ಮಾರ ಕುಷ್ಟಾದಿ ತಾಪತ್ರಯ ನಿವಾರಣಂ ।। ೧೬ ।।

    ಅಶ್ವಥ್ಥ ಮೂಲೆ ಅಕ೯ ವಾರೆ ಸ್ಥಿತ್ವಾ ಪಠತಿ ಯ ಪುಮಾನ್
    ಅಚಲಂ ಶ್ರೀಯಮಾಪ್ನೋತಿ ಸಂಗ್ರಾಮೇ ವಿಜಯಂ ತದಾ ।। ೧೭ ।।

    ಲಿಖಿತ್ವಾ ಪೂಜಯೇತ್ ಯಸ್ತು ಸವ೯ತ್ರ ವಿಜಯೀ ಭವೇತ್
    ಯಾ ಕರೇ ಧಾರಯೇನ್ನಿತ್ಯಂ ಸಪುಮಾನ್ ಶಿ್ರೕಯಮಾಪ್ನುಯಾತ್ ।। ೧೮ ।।

    ಭುಧ್ಧಿ೯ಭಲಂ ಯಶೋ ಧೈರ್ಯಂ ನಿಭ೯ಯತ್ವಂ ಅರೋಗತಾ
    ಸುಧಾರಢ್ಯಂ ವಾಕ್ ಸ್ಪುಠತ್ವಂ ಚ ಹನೂಮದ್ ಸ್ಮರಣಾದ್ಭವೇತ್

    ಮಾರಣಂ ವೈರಿಣಂ ಸಾದ್ಯ ಶರಣಂ ಸವ೯ಸಂಪದಾಂ
    ಶೋಕಸ್ಯ ಹರಣೇ ದಕ್ಷಂ ವಂದೇ ತಂ ರಣ ದಾರುಣಂ

    ಸ್ಥಿತ್ವಾತು ಭಂದನೇನ ಯಸ್ತುಜಪಂ ಕರಯತಿ ದ್ವಿಜೈ
    ತಕ್ಷಣಾತ್ ಮುಕ್ತಿಮಾಪ್ನೊತಿ ಸತ್ಯಂ ಶ್ರೀರಾಮಭಾಷಿತಂ

    ಯ ಇದಂ ಪ್ರಾತರುತ್ಥಾಯ ಪಠೇತ್ ಕವಚಂ ಸದಾ
    ಆಯು್ಯರಾರೋಗ್ಯ ಸಂತಾನೈಸ್ತಥಾ ಸ್ತವ್ಯಸ್ತವೊ ಭವೇತ್

    ಇದಂ ಪೂರ್ವಂ ಪಠಿತ್ವಾತು ರಾಮಸ್ಯ ಕವಚಂ ತಥಾಃ
    ಪಠನೀಯಂ ನರೈ ಭಕ್ತ್ಯಾ ನೈಕಮೇವ ಪಠೇತ್ ಕಥಾ

    ಹನೂಮತ್ ಕವಚಂ ಚಾತ್ರ ಶಿ್ರೕರಾಮ ಕವಚಂ ವಿನಾ
    ಏ ಪದಂತಿ ನರ್ಚಾತ್ರಪದಾನಾಂ ತದ್ ವೃಥಾ ಭವೀತ್

    ತಸ್ಮಾದ್ ಸ್ಮರೈ ಪದನೀಯಮ್ ಸವಾ೯ದ್ ಕವಚ ದ್ವಯಂ
    ರಮಸ್ಯ ವಾಯುಪುತ್ರಾಯ ಶಭ್ದಕಥೈಶ್ಚ ವಿಷೇಶತಃ

    ಬ್ರಹ್ಮಾಂಡ ಪುರಾಣಾಂತರ್ ಗತೇ ನಾರದ ಅಗಸ್ತ್ಯ ಸಂವಾದೇ
    ಶ್ರೀರಾಮಚಂದ್ರ ಕಥಿತಂ ಪಂಚಮುಖೇಕ ಏಕ ಮುಖೀ ಹನುಮಾನ್ ಕವಚಂ
    ಓಂ ತತ್ ಸತ್ ನ

    Reply

  473. Posted by amma on July 20, 2011 at 1:51 am

    Hi
    I have typed Kavacha in Kannada. It is eka mukha hanuman kavacha . there are other kavacha’s also.
    best regards Amma dumma
    ಹನುಮಾನ್ ಪೂವ೯ತಃ ಪಾತು ದಕ್ಷಿಣೇ ಪವನಾತ್ಮಜಃ
    ಪ್ರತೀಚ್ಯಾಂ ಪಾತುರಕ್ಷೋಙ ಉತ್ತರಸ್ಯಾಭ್ಧಿಂ ಪಾರಗಃ ।। ೧ ।।

    ಉದೀಚ್ಯಾಂ ಊದ್ವ೯ಗಃ ಪಾತು ಕೇಸರೀ ಪ್ರಿಯನಂದನಃ
    ಅಧಃಶ್ಚ ವಿಷ್ಣು ಭಕ್ತಸ್ತು ಪಾತು ಮದೆ್ಯೕತು ಪಾವನಿ ।। ೨ ।।

    ಅವಾಂತರ ದಿಶಃ ಪಾತು ಸೀತಾಶೋಕವಿನಾಶನಃ
    ಲಂಕಾವಿದಾಹಕಃ ಪಾತು ಸವಾ೯ಪದ್ ಭ್ಯೋ ನಿರಂತರಂ ।। ೩ ।।

    ಸುಗ್ರೀವ ಸಚಿವಪಾತು ಮಸ್ತಕಂ ವಾಯುನಂದನಃ
    ಭಾಲಂ ಪಾತು ಮಹಾವೀರೋ ಭ್ರುವೊರ್ಮಧ್ಯೇ ನಿರಂತರಂ ।। ೪ ।।

    ನೀತ್ರೇ ಛಾಯಾಪಹಾರೀ ಚ ಪಾತು ನಃ ಪ್ಲವಗೇಶ್ವರಃ
    ಕಪೊಲೌ ಕಣ೯ಮೂಲೇ ಚ ಪಾತು ಶ್ರೀರಾಮ ಕಿಂಕರಃ ।। ೫ ।।

    ನಾಸಾಗ್ರಮ್ ಅಂಜನೀಸೂನುವ೯ಕ್ತ್ರಂ ಪಾತು ಕಪೀಶ್ವರಃ
    ವಾಚಂ ರುದ್ರಪಿ್ರಯ ಪಾತು ಜಿಹ್ವಾಂ ಪಿಂಗಳ ಲೋಚನಃ ।। ೬ ।।

    ಪಾತು ದಂತಂ ಫಲ್ಗುಣೇಷ್ಟ ಸ್ಚುಂಬಕಂ ದೈತ್ಯ ಪ್ರಾಣಹೃತ್
    ಪಾತು ಕಂಠಶ್ಚ ದೈತ್ಯಾರಿಃ ಸ್ಕನ್ದೌ ಪಾತು ಸುರಾ೯ಚಿ ತಃ ।। ೭ ।।

    ಭುಜೌ ಪಾತು ಮಹಾ ತೇಜಾಃ ಕರೌತು ಚರಣಾಯುಧಃ
    ನಖಾಂನಖಾಯುಧ ಪಾತು ಕುಕ್ಷಿಂ ಪಾಕು ಕಪೀಶ್ವರಃ ।। ೮ ।।

    ವಕ್ಷೋ ಮುದ್ರಾಪಹಾರೀ ಚ ಪಾತು ಪಾ೯ಶೆ್ವೕ ಭುಜಾಯುಧಃ
    ಲಂಕಾವಿಭಂಜನಃ ಪಾತು ಪೃಷ್ಟದೀಶೀ ನಿರಂತರಂ ।। ೯ ।।

    ನಾಭಿಂ ಚ ರಾಮಧೂತೋಸು್ತ ಕಟಿಂ ಪಾತು ನಿಲಾತ್ಮಜಃ
    ಗುಹ್ಯಂ ಪಾತು ಮಹಾ ಪ್ರಾಜ್ಞಃ ಲಿಂಗಂ ಪಾತು ಶಿವಪ್ರಿಯಃ ।। ೧೦ ।।

    ಊರೂ ಚ ಜಾನುನೀ ಪಾತು ಲಂಕಾ ಪ್ರಾಸಾದ ಭಂಜನಃ
    ಜಂಗೇ ಪಾತು ಮಹಾಬಾಹು ಗುಲ್ಪೌ ಪಾತು ಮಹಾಬಲಃ ।। ೧೧ ।।

    ಅಚಲೋ ದಾ್ವರಕಃ ಪಾತು ಪಾದೌ ಭಾಸ್ಕರ ಸನ್ನಿಭಃ
    ಅಂಜನೀಸುತ ಸತಾ್ವಢ್ಯಃ ಪಾತು ಪಾದಾಂಗುಲೀಸ್ತಥಾ ।। ೧೨ ।।

    ಸ೯ವಾಂಗಾನಿ ಮಹಾವೀರಃ ಪಾತು ರೋಮಾಣಿ ಚಾತ್ಮವಾನ್
    ಹನುಮತ್ಕವಚಂ ಯಸ್ತು ಪಠೇದಿ್ವದಾ್ವನ್ ವಿಚಕ್ಷಣಃ ।। ೧೩ ।।

    ಶ್ರೀರಾಮಾದಾಗ್ರೇ ಹನುಮದಾಗ್ರೇ ಯಃ ಪಠೇಚ್ಚ ನರಃ ಸದಾ
    ಸಏವ ಪುರುಷಶ್ರೇಷ್ಟೋ ಭಕಿ್ತಂ ಮುಕ್ತಿಂ ಚ ವಿಂದತಿ ।। ೧೪ ।।

    ತ್ರಿಕಾಲಂ ಏಕಕಾಲಂವಾ ಪಠನ್ಮಾಸ ತ್ರಯಂ ನರಃ
    ಸವಾ೯ನ್ ರಿಪೂನ್ ಕ್ಷಣಾತ್ ಜಿ